[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08194.1
DDBJ      :             Oxidoreductase FAD-binding region
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  393/915 : Eukaryota  103/199 : Viruses  0/175   --->[See Alignment]
b.43.4c.25.1d.115.1d.131.1d.15.4
:340 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->323 1krhA PDBj 4e-27 32.1 %
:RPS:PDB   1->339 1amoA PDBj 3e-42 9.5 %
:RPS:SCOP  1->88 2piaA3  d.15.4.2 * 1e-16 25.0 %
:RPS:SCOP  65->250 1pvwA  d.115.1.2 * 4e-26 11.8 %
:RPS:SCOP  271->339 1t6lA2  d.131.1.2 * 5e-07 10.6 %
:HMM:SCOP  1->94 1jq4A_ d.15.4.2 * 5.1e-19 31.9 %
:HMM:SCOP  95->196 1tvcA1 b.43.4.2 * 2.4e-25 31.4 %
:HMM:SCOP  188->337 1i7pA2 c.25.1.1 * 1.1e-30 26.9 %
:RPS:PFM   12->81 PF00111 * Fer2 2e-06 40.6 %
:RPS:PFM   108->196 PF00970 * FAD_binding_6 6e-11 37.5 %
:RPS:PFM   211->319 PF00175 * NAD_binding_1 7e-07 36.7 %
:HMM:PFM   108->197 PF00970 * FAD_binding_6 6.8e-24 38.2 89/99  
:HMM:PFM   8->83 PF00111 * Fer2 6e-18 41.7 72/77  
:HMM:PFM   211->320 PF00175 * NAD_binding_1 4.3e-17 25.2 103/109  
:BLT:SWISS 15->340 TMOF_PSEME 3e-57 40.8 %
:PROS 110->119|PS00142|ZINC_PROTEASE
:PROS 38->46|PS00197|2FE2S_FER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08194.1 GT:GENE ABF08194.1 GT:PRODUCT Oxidoreductase FAD-binding region GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1426985..1428007) GB:FROM 1426985 GB:TO 1428007 GB:DIRECTION - GB:PRODUCT Oxidoreductase FAD-binding region GB:PROTEIN_ID ABF08194.1 GB:DB_XREF GI:93354105 InterPro:IPR001041 InterPro:IPR001221 InterPro:IPR001433 InterPro:IPR001834 InterPro:IPR006025 InterPro:IPR006058 InterPro:IPR008333 LENGTH 340 SQ:AASEQ MSEHQILIEGEKNAFVQAGEDTVLRAALRAGIGFPYECNSGGCGSCKFDLLDGEAENLWPDAPGLTERDRRKGRLLACQCRAKGNIQIKVRVEADHQAQVRPKRLLAKFVESHEVTHDIREFRFVTDGPATFLAGQYAMLSVPGVTAPRAYSMSNTGNDRGEWHFQIRRVPQGKATEQLFHHLRAGDQLEIDGPYGLAFLRTEAPRDIVCVAGGSGLAPMVSIARGASQSGMLETRHLHFFYGGRTPSDICGESFLRMLRGYDERIHFYPVVSLPGEASGFQWSGETGFVHDVVRRVFGDTLSNFEFYFAGPPPMTQALQEMLMIGYCVPFEQLHFDRFF GT:EXON 1|1-340:0| BL:SWS:NREP 1 BL:SWS:REP 15->340|TMOF_PSEME|3e-57|40.8|314/326| PROS 110->119|PS00142|ZINC_PROTEASE|PDOC00129| PROS 38->46|PS00197|2FE2S_FER_1|PDOC00175| BL:PDB:NREP 1 BL:PDB:REP 2->323|1krhA|4e-27|32.1|302/337| RP:PDB:NREP 1 RP:PDB:REP 1->339|1amoA|3e-42|9.5|336/601| RP:PFM:NREP 3 RP:PFM:REP 12->81|PF00111|2e-06|40.6|64/71|Fer2| RP:PFM:REP 108->196|PF00970|6e-11|37.5|88/99|FAD_binding_6| RP:PFM:REP 211->319|PF00175|7e-07|36.7|98/107|NAD_binding_1| HM:PFM:NREP 3 HM:PFM:REP 108->197|PF00970|6.8e-24|38.2|89/99|FAD_binding_6| HM:PFM:REP 8->83|PF00111|6e-18|41.7|72/77|Fer2| HM:PFM:REP 211->320|PF00175|4.3e-17|25.2|103/109|NAD_binding_1| GO:PFM:NREP 6 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00111|IPR001041| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF00111|IPR001041| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00970|IPR008333| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00970|IPR008333| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00175|IPR001433| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00175|IPR001433| RP:SCP:NREP 3 RP:SCP:REP 1->88|2piaA3|1e-16|25.0|84/98|d.15.4.2| RP:SCP:REP 65->250|1pvwA|4e-26|11.8|186/219|d.115.1.2| RP:SCP:REP 271->339|1t6lA2|5e-07|10.6|66/123|d.131.1.2| HM:SCP:REP 1->94|1jq4A_|5.1e-19|31.9|94/98|d.15.4.2|1/1|2Fe-2S ferredoxin-like| HM:SCP:REP 95->196|1tvcA1|2.4e-25|31.4|102/0|b.43.4.2|1/1|Riboflavin synthase domain-like| HM:SCP:REP 188->337|1i7pA2|1.1e-30|26.9|145/0|c.25.1.1|1/1|Ferredoxin reductase-like, C-terminal NADP-linked domain| OP:NHOMO 1021 OP:NHOMOORG 500 OP:PATTERN ---------------------------1-3-------------------1-----------------1 -2-22--1111---1--22-22--2522222122326198--12--------1-------411-1-212-------------------1111-111----3--111111---------------------1----1---------1-1-111--------------------------------------------------1------11--------1--------------------------------------------------------------------------------------------------------1--1-------2-1-1----------1----1--2----111-1-------12--------12327--1---------------2-12311512----111-1111111223----131-11-11--------4---1----------------------------------2-1-15443433535533334448333313856386811445552311442151142111112222222211177--111-11-11--------121------12---------------------------33532331332235222212424325322235--1-211------1111-111111111111-111111111111111111233321222212212212212222121111111--233333333333--12-----12223222311111111111111122212121216155553433644533111---------134321111133233--------------1---11--------------1-------------------------1-111-1------ --------21----1-3122332463311111111111-11111112223242221--12221--21111---21-----1-----11-1-13111----111212-1-13-3--2------1------732-----------1---1-------1---111-2-1-------11---17----322762211-2332- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 340 STR:RPRED 100.0 SQ:SECSTR cTTccccccTTcEEEEcccccHHHHHHHHHHHTccccccccEEcccTTccccccccccccHHHHHHHTccccccccHHHHHHGGGGcccHHHHHHHHHTTccccHHHHHHHHHTTTTTccHHHHHHHcTTccccHHHHHHHccccccEEEEccccTTTcTTEEEEEEEccEEEcTTccHHHHHccccEEEEEEEcccccccccTTccEEEEEEGGGGHHHHHHHHHHHHHHHTcccEEEEEEEccTTTccTTHHHHHHHHHTTcccEEEEEETTcccccTcccHHHHHHHTHHHHHHHHHHHTccEEEEEEETTTHHHHHHHHHHHHHHHHTTccHHHHH DISOP:02AL 1-1| PSIPRED ccEEEEEEccccEEEEEcccccHHHHHHHccccccccccccccccEEEEEEEccccccccccccccHHHHHcccEEEEEEEEcccccEEEcccccccccccEEEEEEEEEEEEEccccEEEEEEEccccccccccEEEEEEEcccccEEEEEEccccccccEEEEEEEEEcccHHHHHHHHHcccccEEEEEccccccEEcccccccEEEEEccHHHHHHHHHHHHHHHccccccccEEEEEEEccHHHHccHHHHHHHHHHcccEEEEEEEcccccccccccccccccHHHHHHHHccccccccEEEEEccHHHHHHHHHHHHHcccccHHHEEEcccc //