[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08197.1
DDBJ      :             Rieske (2Fe-2S) region
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.33.1
:111 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->111 1sjgA PDBj 1e-35 53.2 %
:RPS:PDB   1->102 3c0dB PDBj 8e-21 18.8 %
:RPS:SCOP  1->99 3c0dA1  b.33.1.3 * 4e-22 18.2 %
:HMM:SCOP  1->108 1fqtA_ b.33.1.1 * 1.2e-26 30.8 %
:RPS:PFM   10->89 PF00355 * Rieske 7e-08 34.2 %
:HMM:PFM   5->95 PF00355 * Rieske 2.9e-20 30.3 89/97  
:BLT:SWISS 1->111 TMOC_PSEME 4e-35 53.2 %
:PROS 1->25|PS00430|TONB_DEPENDENT_REC_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08197.1 GT:GENE ABF08197.1 GT:PRODUCT Rieske (2Fe-2S) region GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1429503..1429838) GB:FROM 1429503 GB:TO 1429838 GB:DIRECTION - GB:PRODUCT Rieske (2Fe-2S) region GB:PROTEIN_ID ABF08197.1 GB:DB_XREF GI:93354108 InterPro:IPR005806 InterPro:IPR010916 LENGTH 111 SQ:AASEQ MTFKKVCSLDDLWEGEMESFEVDGQEILMVWPQGGDLKAFQGICPHQDIPLIEGKFDGKTVICRAHLWQFDACSGKGINPSDCALAEYPIKIEGDAVFVETEGVKPLFAHT GT:EXON 1|1-111:0| BL:SWS:NREP 1 BL:SWS:REP 1->111|TMOC_PSEME|4e-35|53.2|111/112| PROS 1->25|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| BL:PDB:NREP 1 BL:PDB:REP 1->111|1sjgA|1e-35|53.2|111/112| RP:PDB:NREP 1 RP:PDB:REP 1->102|3c0dB|8e-21|18.8|101/104| RP:PFM:NREP 1 RP:PFM:REP 10->89|PF00355|7e-08|34.2|79/95|Rieske| HM:PFM:NREP 1 HM:PFM:REP 5->95|PF00355|2.9e-20|30.3|89/97|Rieske| GO:PFM:NREP 3 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00355|IPR017941| GO:PFM GO:0051537|"GO:2 iron, 2 sulfur cluster binding"|PF00355|IPR017941| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00355|IPR017941| RP:SCP:NREP 1 RP:SCP:REP 1->99|3c0dA1|4e-22|18.2|99/108|b.33.1.3| HM:SCP:REP 1->108|1fqtA_|1.2e-26|30.8|107/109|b.33.1.1|1/1|ISP domain| OP:NHOMO 54 OP:NHOMOORG 43 OP:PATTERN --------1--1-11----1-----------------------------------------------1 --1----------------------1-------111--11--1---------------11--------111-----------------------------------------------------------------111------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------21-23------------------------1--------------------3------------------------1----------------------------------------111--------------1-----------1-1--11--3----2------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEGGGccTcEEcEEEETTEEEEEEEETTTEEEEEEcccTTTccccGGccETTEEEEcTTTccEEETTTccccccccccccEEcEEEcccEEEEEcccccccTTcc DISOP:02AL 108-112| PSIPRED ccEEEEEEHHHcccccEEEEEEccEEEEEEEccccEEEEEEccccccccEEEEEEEcccEEEEcccccEEEccccEEEccccccccEEEEEEEccEEEEEccccccccccc //