[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08207.1
DDBJ      :             catechol 2,3-dioxygenase
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  58/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:314 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->314 1mpyA PDBj 6e-72 44.0 %
:RPS:PDB   2->312 2ei2A PDBj 4e-32 19.9 %
:RPS:SCOP  2->142 1mpyA1  d.32.1.3 * 1e-20 43.3 %
:RPS:SCOP  144->314 1mpyA2  d.32.1.3 * 3e-54 43.1 %
:HMM:SCOP  1->314 1sp9A_ d.32.1.3 * 7.2e-45 30.4 %
:HMM:PFM   5->113 PF00903 * Glyoxalase 2.1e-07 22.0 109/128  
:HMM:PFM   162->271 PF00903 * Glyoxalase 1.9e-20 22.7 110/128  
:BLT:SWISS 2->314 XYLE_PSEAE 1e-72 44.7 %
:PROS 250->271|PS00082|EXTRADIOL_DIOXYGENAS

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08207.1 GT:GENE ABF08207.1 GT:PRODUCT catechol 2,3-dioxygenase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1437669..1438613) GB:FROM 1437669 GB:TO 1438613 GB:DIRECTION - GB:PRODUCT catechol 2,3-dioxygenase GB:PROTEIN_ID ABF08207.1 GB:DB_XREF GI:93354118 InterPro:IPR000486 InterPro:IPR004360 InterPro:IPR011588 LENGTH 314 SQ:AASEQ MGVMRIGHASLKVMDMALAIKHYENVLGMKRTMEDEHGNVYLKCWDEWDKYSVILTPSDQAGLNHVAYKVEHDADLDALQKRIEAYGFKTQMLPEGTLPSTGRMLQFNLPSGHEMRLFATKEYVGTGVGTTNPDPWPDDVKGAGAHWLDHCLLMCELNPETGVNRVAENTRFMKECLDFYLAEQVMVGPDSSIQAATWMFRTSTPHDIAFVGGPRNGLHHIAFFLDSWHDVLKSADVMAKNKVKIDVAPTRHGITRGETIYFFDPSGNRNETFAGLGYLAQPDRPVTTWTEEHLGSGIFYHTGELVQSFTEVYT GT:EXON 1|1-314:0| BL:SWS:NREP 1 BL:SWS:REP 2->314|XYLE_PSEAE|1e-72|44.7|302/307| PROS 250->271|PS00082|EXTRADIOL_DIOXYGENAS|PDOC00078| BL:PDB:NREP 1 BL:PDB:REP 2->314|1mpyA|6e-72|44.0|302/307| RP:PDB:NREP 1 RP:PDB:REP 2->312|2ei2A|4e-32|19.9|291/299| HM:PFM:NREP 2 HM:PFM:REP 5->113|PF00903|2.1e-07|22.0|109/128|Glyoxalase| HM:PFM:REP 162->271|PF00903|1.9e-20|22.7|110/128|Glyoxalase| RP:SCP:NREP 2 RP:SCP:REP 2->142|1mpyA1|1e-20|43.3|141/145|d.32.1.3| RP:SCP:REP 144->314|1mpyA2|3e-54|43.1|160/162|d.32.1.3| HM:SCP:REP 1->314|1sp9A_|7.2e-45|30.4|286/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 97 OP:NHOMOORG 68 OP:PATTERN ------1121121221---------------------------------------------------- -----1---------------------------1112-24-----1-------21111---------1--------------2-----------------------------------------------------11111----6-------------------------------------1-112---2----------1----------------11-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------12-----1-11---------------------1---2------1----------1-1-1---------------------------------------------------11--1-------------------------21--111--11-12-2------1--------------------33------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 314 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEEEEEcccHHHHHHHHHHTTccEEEccccTTEEEEEcccTTccccEEEEcccccEEEEEEEEEccHHHHHHHHHHHHHTTcccEEccHHHHHTEEEEEEEEcTTccEEEEEEEEcccTTcccccccccccccccGGccGcccEEEEccEEEEcTTcccHHHHHHHHHHTTcEEEEEEEEEcTTccEEEEEEEEcccccccEEEcccccccEEEEEEEEccHHHHHHHHHHHHHTTccEEEEEEEcTTTccEEEEEEcTTccEEEEEEccccccccccccccccccccccccEEcccccccccccccc DISOP:02AL 1-1| PSIPRED ccccEEEEEEEEEccHHHHHHHHHHHcccEEEEEccccEEEEEEccccccEEEEEEEcccccEEEEEEEEccHHHHHHHHHHHHHcccEEEEEcccccccccEEEEEEcccccEEEEEEcccccccccccccccccccccccccEEEEcEEEEccccccccccccHHHHHHHHHHHcccEEEEEEEEcccccEEEEEEEEEccccccEEEEccccccEEEEEEEcccHHHHHHHHHHHHHcccEEEEEEEEccccccEEEEEEcccccEEEEEccccEEEccccccEEEcHHHcccEEEEccccccccHHHccc //