[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08212.1
DDBJ      :             monooxygenase component MmoB/DmpM
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.137.1
:89 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->89 1hqiA PDBj 6e-22 45.5 %
:RPS:PDB   2->88 2bf5B PDBj 1e-28 29.9 %
:RPS:SCOP  2->89 1hqiA  d.137.1.1 * 7e-30 45.5 %
:HMM:SCOP  1->88 1ckvA_ d.137.1.1 * 4.1e-30 44.3 %
:RPS:PFM   4->87 PF02406 * MmoB_DmpM 4e-20 51.2 %
:HMM:PFM   1->87 PF02406 * MmoB_DmpM 4.1e-35 43.7 87/87  
:BLT:SWISS 2->89 DMPM_PSEUF 2e-21 45.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08212.1 GT:GENE ABF08212.1 GT:PRODUCT monooxygenase component MmoB/DmpM GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1442068..1442337) GB:FROM 1442068 GB:TO 1442337 GB:DIRECTION - GB:PRODUCT monooxygenase component MmoB/DmpM GB:PROTEIN_ID ABF08212.1 GB:DB_XREF GI:93354123 InterPro:IPR003454 LENGTH 89 SQ:AASEQ MSNVFIAFQANEESRSVVEAILADNPNAVATESPGMVKIDAPGHLTINRRSIEDRIGMKFDLQQIHINLITLSGYIDEDDEQFTLSWKH GT:EXON 1|1-89:0| BL:SWS:NREP 1 BL:SWS:REP 2->89|DMPM_PSEUF|2e-21|45.5|88/100| BL:PDB:NREP 1 BL:PDB:REP 2->89|1hqiA|6e-22|45.5|88/90| RP:PDB:NREP 1 RP:PDB:REP 2->88|2bf5B|1e-28|29.9|87/91| RP:PFM:NREP 1 RP:PFM:REP 4->87|PF02406|4e-20|51.2|84/87|MmoB_DmpM| HM:PFM:NREP 1 HM:PFM:REP 1->87|PF02406|4.1e-35|43.7|87/87|MmoB_DmpM| GO:PFM:NREP 2 GO:PFM GO:0004497|"GO:monooxygenase activity"|PF02406|IPR003454| GO:PFM GO:0006725|"GO:cellular aromatic compound metabolic process"|PF02406|IPR003454| RP:SCP:NREP 1 RP:SCP:REP 2->89|1hqiA|7e-30|45.5|88/90|d.137.1.1| HM:SCP:REP 1->88|1ckvA_|4.1e-30|44.3|88/141|d.137.1.1|1/1|Monooxygenase (hydroxylase) regulatory protein| OP:NHOMO 20 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--212--11-12-1------1--------------------21------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------1------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 88 STR:RPRED 98.9 SQ:SECSTR #cEEEEEEEccTTHHHHHHHHHHHcTTcccEEcccEEEEEEEcEEEEEHHHHHHHHTccccHHHHHHTEEEEEcEEEEcccEEEEEccc DISOP:02AL 1-1,89-90| PSIPRED ccEEEEEEEcccHHHHHHHHHHHccccEEEEcccEEEEEEcccEEEEEHHHHHHHHcccccHHHEEEEEEEEccEEEEEccEEEEEEcc //