[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08225.1
DDBJ      :             Conjugal transfer protein TrbC
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:127 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   30->117 PF04956 * TrbC 2.1e-27 43.0 86/100  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08225.1 GT:GENE ABF08225.1 GT:PRODUCT Conjugal transfer protein TrbC GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1451805..1452188 GB:FROM 1451805 GB:TO 1452188 GB:DIRECTION + GB:PRODUCT Conjugal transfer protein TrbC GB:PROTEIN_ID ABF08225.1 GB:DB_XREF GI:93354136 InterPro:IPR007039 LENGTH 127 SQ:AASEQ MTQMTISAFRVSVNPALRLARLRSLARPAGQGLLLAALLLFLAGTAQAAGSSMPWEGPLQSILESIQGPVARIVAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV GT:EXON 1|1-127:0| TM:NTM 3 TM:REGION 27->49| TM:REGION 68->90| TM:REGION 101->123| SEG 15->50|palrlarlrslarpagqglllaalllflagtaqaag| SEG 70->81|varivaviiiia| SEG 103->125|fglsiafaassfflsffsfsgga| HM:PFM:NREP 1 HM:PFM:REP 30->117|PF04956|2.1e-27|43.0|86/100|TrbC| OP:NHOMO 71 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3--1-------1-4--321-------------1-------1-323-------------161----3----------------43----1-------------------------------112-----2-----1-----11------1-------2---11--11221--------------------------------------------------------------------------------------------------------1----------------1------------------------------------------------------------------------------------------------------------------------------------1--11--------------------------------------1------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccEEEEEEEEEEccHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //