[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08234.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:81 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   6->69 PF10038 * DUF2274 9e-15 68.8 %
:HMM:PFM   5->70 PF10038 * DUF2274 9.1e-32 56.1 66/69  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08234.1 GT:GENE ABF08234.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1460361..1460606 GB:FROM 1460361 GB:TO 1460606 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF08234.1 GB:DB_XREF GI:93354145 LENGTH 81 SQ:AASEQ MSATKKLRLGPLPKTENVKLTFACPASLKADLDRYAALHAQAYGEAVDAEKLIPHMLEAFMAGDRGFRKGTTTRSAPSKPT GT:EXON 1|1-81:0| RP:PFM:NREP 1 RP:PFM:REP 6->69|PF10038|9e-15|68.8|64/69|DUF2274| HM:PFM:NREP 1 HM:PFM:REP 5->70|PF10038|9.1e-32|56.1|66/69|DUF2274| OP:NHOMO 33 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1-1-3--------------------1----------------1---------------------------------------11----2-----1-----11------1-------2---11--12221--------------------------------------------------------------------------------------------------------1----------------1------------------------------------------------------------------------------------------------------------------------------------1---1--------------------------------------1------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,71-82| PSIPRED ccHHHHcccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHccccccccccc //