[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08238.1
DDBJ      :             putative transmembrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:75 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->54 PF11804 * DUF3325 0.0001 22.0 50/106  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08238.1 GT:GENE ABF08238.1 GT:PRODUCT putative transmembrane protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1463804..1464031) GB:FROM 1463804 GB:TO 1464031 GB:DIRECTION - GB:PRODUCT putative transmembrane protein GB:PROTEIN_ID ABF08238.1 GB:DB_XREF GI:93354149 LENGTH 75 SQ:AASEQ MYIVAIGWLYVVLMMSITETNAVAGVATFLFYGLAPVAIVMYIMGTPGRRRRRKAREAGEAAAAKTAESESKAGQ GT:EXON 1|1-75:0| TM:NTM 2 TM:REGION 1->22| TM:REGION 24->45| SEG 48->74|grrrrrkareageaaaaktaeseskag| HM:PFM:NREP 1 HM:PFM:REP 5->54|PF11804|0.0001|22.0|50/106|DUF3325| OP:NHOMO 18 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--1111--111--11-11----1------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 48-76| PSIPRED cEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcc //