[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08260.1
DDBJ      :             Sulfate ABC transporter, permease protein CysW
Swiss-Prot:             

Homologs  Archaea  50/68 : Bacteria  643/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:305 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   59->244 3d31C PDBj 9e-22 30.8 %
:RPS:PDB   197->228 3dhwA PDBj 4e-09 31.2 %
:RPS:SCOP  53->266 2r6gG1  f.58.1.1 * 2e-23 19.3 %
:RPS:PFM   94->245 PF00528 * BPD_transp_1 2e-07 32.2 %
:HMM:PFM   100->292 PF00528 * BPD_transp_1 2.3e-19 21.9 178/185  
:BLT:SWISS 36->266 CYSW_ECOLI 8e-76 55.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08260.1 GT:GENE ABF08260.1 GT:PRODUCT Sulfate ABC transporter, permease protein CysW GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1486171..1487088 GB:FROM 1486171 GB:TO 1487088 GB:DIRECTION + GB:PRODUCT Sulfate ABC transporter, permease protein CysW GB:PROTEIN_ID ABF08260.1 GB:DB_XREF GI:93354171 InterPro:IPR000515 InterPro:IPR005667 InterPro:IPR011866 LENGTH 305 SQ:AASEQ MAGAISRLGGPGAPGAPSAHVQAAQFPHDATGESRWVRYGLITVAVLFLGLFLFIPLASVFYEALRKGVDTYLAALTEPDAVSAIKLTLTVAAIAVPLNVVFGVAAAWAIAKFDFRGKNLLITLIDLPFSVSPVISGLIYVLMFGAQGWFGPWLEAHDIKIMFAVPGIVLATIFVTFPFVARELIPLMQAQGSEEEEAAIVLGASGWQTFWHVTLPNIRWGLLYGVILCNARAMGEFGAVSVVSGHIRGLTNTMPLHVEILYNEYNFAAAFAVASLLTLLALVTLGIKTLVEIRASREQLEGQPS GT:EXON 1|1-305:0| BL:SWS:NREP 1 BL:SWS:REP 36->266|CYSW_ECOLI|8e-76|55.4|231/291| TM:NTM 6 TM:REGION 39->61| TM:REGION 87->109| TM:REGION 122->144| TM:REGION 163->185| TM:REGION 223->245| TM:REGION 270->292| SEG 9->19|ggpgapgapsa| SEG 267->285|faaafavaslltllalvtl| BL:PDB:NREP 1 BL:PDB:REP 59->244|3d31C|9e-22|30.8|185/248| RP:PDB:NREP 1 RP:PDB:REP 197->228|3dhwA|4e-09|31.2|32/203| RP:PFM:NREP 1 RP:PFM:REP 94->245|PF00528|2e-07|32.2|143/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 100->292|PF00528|2.3e-19|21.9|178/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 53->266|2r6gG1|2e-23|19.3|207/284|f.58.1.1| OP:NHOMO 2300 OP:NHOMOORG 700 OP:PATTERN --112211111111111------2212231221-21-25555313154-1533-3523412---1--- --2131112232--33333-34--34333333444444441-1-231132212131-1--11212222211-------1111411111----11-----------1-1-----------------12122123212111221125323543332355------33235551------------3113312-51132323653433354353221133514442-1211212A8111111111111111111112--------------------------------1--------------------------1--111-----221344433431321444----312113246144213211-12211-12-1-3333-----335953354656656655666669-44433344464-888496587888861--14A689964122222222-33-2534-------------------------------111-4663433474434665889777774784A6546-2776432335385567981333683444444222243-36253221-5221-53213345-313242133-211-11--1-1111111112311114321311----14444121444616226222---32-------44332554444444444-4444444444444334434666674355555555554555555444434442-59978999998922-1---------4-51743441411111111344434233445534437567687753977---------12223444445527522333333332222--12332222--------1----1----------------------1443112153-5- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------222-----12---1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 186 STR:RPRED 61.0 SQ:SECSTR ##########################################################HHHHHHHHHTHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccTTHHHHHHHHHGGGTccHHHHHHHHHHHHcTTcTTTGGGTTTccccTTcHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTccHHHHHHH############################################################# DISOP:02AL 1-3,5-6,17-31,293-306| PSIPRED ccHHHHHccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //