[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08277.1
DDBJ      :             acyl-coA-binding protein, ACBP
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  69/915 : Eukaryota  141/199 : Viruses  0/175   --->[See Alignment]
a.11.1
:89 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->83 2fdqA PDBj 1e-17 44.3 %
:RPS:PDB   1->83 2cquA PDBj 7e-18 41.0 %
:RPS:SCOP  5->86 1hb6A  a.11.1.1 * 2e-16 42.7 %
:HMM:SCOP  3->89 1hbkA_ a.11.1.1 * 2.2e-26 43.7 %
:RPS:PFM   4->87 PF00887 * ACBP 8e-17 46.4 %
:HMM:PFM   4->85 PF00887 * ACBP 6.8e-31 45.1 82/87  
:BLT:SWISS 4->83 ACBP_SCHPO 5e-19 47.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08277.1 GT:GENE ABF08277.1 GT:PRODUCT acyl-coA-binding protein, ACBP GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1503682..1503951) GB:FROM 1503682 GB:TO 1503951 GB:DIRECTION - GB:PRODUCT acyl-coA-binding protein, ACBP GB:PROTEIN_ID ABF08277.1 GB:DB_XREF GI:93354188 InterPro:IPR000582 LENGTH 89 SQ:AASEQ MSDLQTRFDQAQIDVKTLSERPNNMTLLRLYALYKQGAEGDAHGDKPGMTDFVGRYKFEAWEALKGTGREEAMQKYIELVTDLLEGKAS GT:EXON 1|1-89:0| BL:SWS:NREP 1 BL:SWS:REP 4->83|ACBP_SCHPO|5e-19|47.5|80/87| BL:PDB:NREP 1 BL:PDB:REP 5->83|2fdqA|1e-17|44.3|79/86| RP:PDB:NREP 1 RP:PDB:REP 1->83|2cquA|7e-18|41.0|83/116| RP:PFM:NREP 1 RP:PFM:REP 4->87|PF00887|8e-17|46.4|84/84|ACBP| HM:PFM:NREP 1 HM:PFM:REP 4->85|PF00887|6.8e-31|45.1|82/87|ACBP| GO:PFM:NREP 1 GO:PFM GO:0000062|"GO:acyl-CoA binding"|PF00887|IPR000582| RP:SCP:NREP 1 RP:SCP:REP 5->86|1hb6A|2e-16|42.7|82/86|a.11.1.1| HM:SCP:REP 3->89|1hbkA_|2.2e-26|43.7|87/0|a.11.1.1|1/1|Acyl-CoA binding protein| OP:NHOMO 526 OP:NHOMOORG 210 OP:PATTERN -------------------------------------------------------------------- --------------------------------------1------------------------------------------------------------------11-----------------------------11111------------------------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111--111-111111111-111----21----------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------111111111----1----------------------------------------------------------------------------------- ----1---1-1-111-1-------1--1111-1----------111------------11111-1111-111-11111111111---1-121111-11122-2411-3-277C23634443565A94D2Tb9-BAE24326347434541533637552212232825321332111116111111333-11--2133- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 86 STR:RPRED 96.6 SQ:SECSTR ccccHHHHHHHHHHHHHccccccHHHHHHHHHHHTTTTTcccccccccTTcHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHH### DISOP:02AL 1-2,64-68,88-90| PSIPRED cccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcc //