[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08286.1
DDBJ      :             Disulphide bond formation protein DsbB
Swiss-Prot:DSBB_RALME   RecName: Full=Disulfide bond formation protein B;AltName: Full=Disulfide oxidoreductase;

Homologs  Archaea  0/68 : Bacteria  122/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.29.15
:161 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->137 2k73A PDBj 7e-05 24.8 %
:RPS:SCOP  10->122 2hi7B1  a.29.15.1 * 1e-22 29.2 %
:RPS:PFM   1->138 PF02600 * DsbB 3e-16 39.9 %
:HMM:PFM   1->152 PF02600 * DsbB 2e-41 42.3 149/156  
:BLT:SWISS 1->161 DSBB_RALME 8e-84 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08286.1 GT:GENE ABF08286.1 GT:PRODUCT Disulphide bond formation protein DsbB GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1514288..1514773 GB:FROM 1514288 GB:TO 1514773 GB:DIRECTION + GB:PRODUCT Disulphide bond formation protein DsbB GB:PROTEIN_ID ABF08286.1 GB:DB_XREF GI:93354197 InterPro:IPR003752 LENGTH 161 SQ:AASEQ MQANSRTYFLLIAIVSFAMVGAALYMQYAENLQPCPLCIMQRFAFIGIGIFSLLAVIAQNTRTLWQGLGMLSGVGGIAVAGYQVALLMNPKASCGIDPLENWVNSLPTAKLLPQVFYSDGLCTAPTPPILGLSIPAWSLIWLLILTLTLAVGLIRREKHFR GT:EXON 1|1-161:0| SW:ID DSBB_RALME SW:DE RecName: Full=Disulfide bond formation protein B;AltName: Full=Disulfide oxidoreductase; SW:GN Name=dsbB; OrderedLocusNames=Rmet_1403; SW:KW Cell inner membrane; Cell membrane; Chaperone; Complete proteome;Disulfide bond; Electron transport; Membrane; Oxidoreductase;Redox-active center; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->161|DSBB_RALME|8e-84|100.0|161/161| GO:SWS:NREP 8 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 4 TM:REGION 9->31| TM:REGION 35->57| TM:REGION 65->87| TM:REGION 131->153| SEG 139->149|liwlliltltl| BL:PDB:NREP 1 BL:PDB:REP 25->137|2k73A|7e-05|24.8|113/183| RP:PFM:NREP 1 RP:PFM:REP 1->138|PF02600|3e-16|39.9|138/158|DsbB| HM:PFM:NREP 1 HM:PFM:REP 1->152|PF02600|2e-41|42.3|149/156|DsbB| GO:PFM:NREP 2 GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF02600|IPR003752| GO:PFM GO:0016020|"GO:membrane"|PF02600|IPR003752| RP:SCP:NREP 1 RP:SCP:REP 10->122|2hi7B1|1e-22|29.2|113/134|a.29.15.1| OP:NHOMO 126 OP:NHOMOORG 123 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111-11111111111111211111111111--1111--1--11--111---------1111----------------------------------------------------------------1-1--1---------1-1111-1-1-----1------------1-1-------------------------------111---111111111111111111-----------11111111111---1-----------1-1---11---1---------1-11111--11-11121111111111----------------------1------------1-1----------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 70.2 SQ:SECSTR ########################HHHHHHTccccHHHHHHHHHHHHHHHHHHHHTTcTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccTTcHHHHcccTTTcccccccccccEETTEEHHHH######################## DISOP:02AL 1-4,159-162| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHcccHHHHHHHHHccccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccc //