[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08292.1
DDBJ      :             binding-protein-dependent transport systems inner membrane component
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  790/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:306 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  91->235 3dhwA1  f.58.1.1 * 2e-11 16.2 %
:RPS:PFM   111->304 PF00528 * BPD_transp_1 6e-07 25.3 %
:HMM:PFM   113->304 PF00528 * BPD_transp_1 1.3e-45 37.7 183/185  
:BLT:SWISS 1->306 GSIC_SALPA e-129 81.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08292.1 GT:GENE ABF08292.1 GT:PRODUCT binding-protein-dependent transport systems inner membrane component GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1522673..1523593 GB:FROM 1522673 GB:TO 1523593 GB:DIRECTION + GB:PRODUCT binding-protein-dependent transport systems inner membrane component GB:PROTEIN_ID ABF08292.1 GB:DB_XREF GI:93354203 InterPro:IPR000515 LENGTH 306 SQ:AASEQ MLNYFLKRLLGVIPTMLIVAVLVFLFVHLLPGDPARLAAGPEADADTVELVRKDLGLDRPMPEQFVRYFSNALRGDFGTSLRTKRPVSEEIGDRFLPTLYLTIASMVWAVIFGMTIGICSAVWRNQWPDRLGMTLAVSGISFPAFALGMLLMEVFSVQLGWLPSIGADSWKHYILPSLTLGAAVAAVMARFTRASFIEVLQEDFVRTARAKGVRETVVVIKHTLRNAMIPVVTMMGLQFGFLLGGSILVEKVFNWPGLGRLLVDAVEMRDYPVIQAEVLLFSLEFILINLVVDVLYTVINPTIRYK GT:EXON 1|1-306:0| BL:SWS:NREP 1 BL:SWS:REP 1->306|GSIC_SALPA|e-129|81.0|306/306| TM:NTM 6 TM:REGION 9->31| TM:REGION 99->121| TM:REGION 138->160| TM:REGION 171->193| TM:REGION 222->244| TM:REGION 282->304| SEG 17->30|livavlvflfvhll| SEG 236->245|glqfgfllgg| RP:PFM:NREP 1 RP:PFM:REP 111->304|PF00528|6e-07|25.3|194/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 113->304|PF00528|1.3e-45|37.7|183/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 91->235|3dhwA1|2e-11|16.2|142/203|f.58.1.1| OP:NHOMO 3674 OP:NHOMOORG 852 OP:PATTERN 4441314266665564453332113336435212---1-----113-52-EA5-54432133314-11 -113D443444-4122322-22112A2222224333387A1A297EB536648B7326115523A5988A42333733323-411111--------2--------11--122222222222222211111111121465952217A3322333221111111132215322111111111111A5433A91423666664564546445A76663655314C521222222E6155545555655556333322222332-12111--33111112234333333311112211111112222222222222231111211111C36244434541422222111153153D-111BA631-282-3462174411----1121132HHP115854B19AAA9AA8AAL-44C43A4DQP1-nRRXJJEXUMOPK4-116CEB7BB7DF1111111123322219-------------------------------11--CFBCC68888654555559955552567E64A7113342363353D5DS241142242-------111221346132352233331111111211----13111111------122222212214-1211663121111151111111211111121121--13321------77KE4987777777777-7777777777777676776BCCCA3366666666666666666976666674-666666656666--1111111111111748444-2333322523222222121235333233658265442ABA1----1---246666666656688--1-------------12112222222121116-11111--2112211222-1212211143854AEA88212 -----------------------------------------------------------------------------------------------------------------1--------------------------------------------2----3---------1-----------1--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 306-307| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //