[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08299.1
DDBJ      :             (2Fe-2S)-binding
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  377/915 : Eukaryota  89/199 : Viruses  0/175   --->[See Alignment]
a.56.1d.15.4
:184 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->184 1sb3C PDBj 2e-20 36.3 %
:RPS:PDB   7->170 3b9jA PDBj 2e-36 30.7 %
:RPS:SCOP  5->88 1dgjA2  d.15.4.2 * 4e-13 33.3 %
:RPS:SCOP  98->170 1ffuA1  a.56.1.1 * 8e-17 32.8 %
:HMM:SCOP  4->88 1fo4A2 d.15.4.2 * 1.4e-15 35.3 %
:HMM:SCOP  83->175 1dgjA1 a.56.1.1 * 5.9e-23 42.7 %
:RPS:PFM   94->168 PF01799 * Fer2_2 2e-15 49.3 %
:HMM:PFM   83->168 PF01799 * Fer2_2 4.4e-27 47.3 74/75  
:HMM:PFM   40->75 PF10418 * DHODB_Fe-S_bind 2.5e-06 39.4 33/40  
:BLT:SWISS 7->169 YAGT_ECO57 2e-20 37.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08299.1 GT:GENE ABF08299.1 GT:PRODUCT (2Fe-2S)-binding GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1531526..1532080 GB:FROM 1531526 GB:TO 1532080 GB:DIRECTION + GB:PRODUCT (2Fe-2S)-binding GB:PROTEIN_ID ABF08299.1 GB:DB_XREF GI:93354210 InterPro:IPR001041 InterPro:IPR002888 LENGTH 184 SQ:AASEQ MIATQALSMNINGKDVGPLEVPVGLMMIDFLHEYVNLTGSRLGCGQGVCHACVAILDHPDGTSETIRTCITGAHFFQGKRVRTVEGHGKRNDKGEVVEMTPVQQAFLKHFSFQCGYCTPGFVNGATVLVEKLKREPVAADKVEQTIMSSMDEHICRCTGYVRYYEAIKDVVTSTPGLVKGKGAQ GT:EXON 1|1-184:0| BL:SWS:NREP 1 BL:SWS:REP 7->169|YAGT_ECO57|2e-20|37.1|151/229| BL:PDB:NREP 1 BL:PDB:REP 7->184|1sb3C|2e-20|36.3|157/161| RP:PDB:NREP 1 RP:PDB:REP 7->170|3b9jA|2e-36|30.7|153/162| RP:PFM:NREP 1 RP:PFM:REP 94->168|PF01799|2e-15|49.3|69/75|Fer2_2| HM:PFM:NREP 2 HM:PFM:REP 83->168|PF01799|4.4e-27|47.3|74/75|Fer2_2| HM:PFM:REP 40->75|PF10418|2.5e-06|39.4|33/40|DHODB_Fe-S_bind| GO:PFM:NREP 3 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01799|IPR002888| GO:PFM GO:0046872|"GO:metal ion binding"|PF01799|IPR002888| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01799|IPR002888| RP:SCP:NREP 2 RP:SCP:REP 5->88|1dgjA2|4e-13|33.3|78/80|d.15.4.2| RP:SCP:REP 98->170|1ffuA1|8e-17|32.8|67/76|a.56.1.1| HM:SCP:REP 4->88|1fo4A2|1.4e-15|35.3|85/90|d.15.4.2|1/1|2Fe-2S ferredoxin-like| HM:SCP:REP 83->175|1dgjA1|5.9e-23|42.7|75/113|a.56.1.1|1/1|CO dehydrogenase ISP C-domain like| OP:NHOMO 1367 OP:NHOMOORG 487 OP:PATTERN 112-1-2322223323--211-1-2---1--------------------------------1------ 13813---------1--11-12--5711111333331369211211---11-111-----1-9-239454--------1---3---1--------------1-245-5----------------------------22211----5-1-1-----------------1-2--------------12-------1-----1---------12---1----21-----------1--------------------1----------------------------------------------------------------------33-14444344333-3------21-1---12-211332-213-------4--3231-----14FFG41337485111111111-1-87C66A9A562-52241184318C7523-66144445462222222263331421------------------------------2241-45445ABBABA1222199CB22221285GCAC4-2665333117141A1131-111------------2211-3-2111111111--1113111311-133-4-------------------------111--4112-4-11222223-111111--1-1----1---------1--1--2221211-21-2222111212211221221------------------------51--1111-----------------------------321---------------1111111-213166663274464552433---------1---1----------1122222----------1-------------------------------------------2211------3- ----1-1-----11-1112111111111112111111111111-11-----------11--1-----------1------------------1-------1-------228111127-----1-13-1------------2-12----1-4-15-------4-57246AC7B3-4-11-7---1121252311-2-111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 182 STR:RPRED 98.9 SQ:SECSTR ##ccccEEEEETTEEEEETTccTTccHHHHHHHTccccccccccccccccTTEEEEEEEcTTEEEEETTTccGGGcTTcEEEcGGGTccTTccEEEccccHHHHHHHHTTcccccTTHHHHHHHHHHHHHHHcccccHHHHTTTHHHHHTTTccccccccHHHHHHHGGGHHHHHHHccTTccc DISOP:02AL 1-4,136-139,174-177,179-185| PSIPRED cccccEEEEEEccEEEEEEcccccccHHHHHHHHcccccccccccccccccEEEEEcccccccccHHHHHHHHHHHcccEEEEEccccccccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHcccc //