[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08301.1
DDBJ      :             putative integral membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:116 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   62->104 PF11776 * DUF3315 4e-10 55.8 %
:HMM:PFM   62->112 PF11776 * DUF3315 5.5e-22 52.9 51/52  
:BLT:SWISS 62->104 YOHN_ECOLI 1e-05 39.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08301.1 GT:GENE ABF08301.1 GT:PRODUCT putative integral membrane protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1533570..1533920 GB:FROM 1533570 GB:TO 1533920 GB:DIRECTION + GB:PRODUCT putative integral membrane protein GB:PROTEIN_ID ABF08301.1 GB:DB_XREF GI:93354212 LENGTH 116 SQ:AASEQ MKTRMLIPIAVAAAGMLAAPFALAQHSGSMKSSGSMSSSPSSSGTAPMGAASPYTPQKWNKGDKLPAEFRDRQYVIDKYKEYNLPAPKKGYHWVGIGADYYQVSSNGTVYSVGPGG GT:EXON 1|1-116:0| BL:SWS:NREP 1 BL:SWS:REP 62->104|YOHN_ECOLI|1e-05|39.5|43/112| SEG 10->24|avaaagmlaapfala| SEG 27->53|sgsmkssgsmssspsssgtapmgaasp| RP:PFM:NREP 1 RP:PFM:REP 62->104|PF11776|4e-10|55.8|43/52|DUF3315| HM:PFM:NREP 1 HM:PFM:REP 62->112|PF11776|5.5e-22|52.9|51/52|DUF3315| OP:NHOMO 30 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111-11-11111111111----1--------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,25-49| PSIPRED cccEEEEEEHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHccccccccHHHcccccEEccHHHccccccccccEEEEEccEEEEEccccEEEEEEccc //