[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08318.1
DDBJ      :             SSU ribosomal protein S2P
Swiss-Prot:RS2_RALME    RecName: Full=30S ribosomal protein S2;

Homologs  Archaea  0/68 : Bacteria  909/915 : Eukaryota  117/199 : Viruses  0/175   --->[See Alignment]
c.23.15
:247 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->245 2gy9B PDBj 3e-80 57.6 %
:RPS:PDB   3->229 3bbnB PDBj 6e-80 38.3 %
:RPS:SCOP  5->235 1fjgB  c.23.15.1 * 4e-92 45.9 %
:HMM:SCOP  5->241 1fjgB_ c.23.15.1 * 5.2e-92 53.2 %
:RPS:PFM   8->222 PF00318 * Ribosomal_S2 2e-73 61.1 %
:HMM:PFM   8->224 PF00318 * Ribosomal_S2 6.9e-85 54.5 211/211  
:BLT:SWISS 1->247 RS2_RALME e-141 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08318.1 GT:GENE ABF08318.1 GT:PRODUCT SSU ribosomal protein S2P GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1556260..1557003 GB:FROM 1556260 GB:TO 1557003 GB:DIRECTION + GB:PRODUCT SSU ribosomal protein S2P GB:PROTEIN_ID ABF08318.1 GB:DB_XREF GI:93354229 InterPro:IPR001865 InterPro:IPR005706 LENGTH 247 SQ:AASEQ MSVTMREMLEAGCHFGHQTRFWNPKMAPFIFGHRNKIHIINLEKTLPMFQDALKYVRQLAANRGTVLFVGTKRQSREILAEEAGRAGMPYVDARWLGGMLTNFKTVKISIKRLKDMEAAKEAGALETMSKKEALMFEREMEKLEKSIGGIKDMGGIPDAIFVVDVGYHKIAVTEANKLGIPVIGVVDTNHSPEGIDYVIPGNDDSSKAVALYVRGVADAILEGRANAVQEVVEAARGDDEFVEVQEG GT:EXON 1|1-247:0| SW:ID RS2_RALME SW:DE RecName: Full=30S ribosomal protein S2; SW:GN Name=rpsB; OrderedLocusNames=Rmet_1435; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->247|RS2_RALME|e-141|100.0|247/247| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| BL:PDB:NREP 1 BL:PDB:REP 5->245|2gy9B|3e-80|57.6|236/236| RP:PDB:NREP 1 RP:PDB:REP 3->229|3bbnB|6e-80|38.3|227/231| RP:PFM:NREP 1 RP:PFM:REP 8->222|PF00318|2e-73|61.1|211/212|Ribosomal_S2| HM:PFM:NREP 1 HM:PFM:REP 8->224|PF00318|6.9e-85|54.5|211/211|Ribosomal_S2| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00318|IPR001865| GO:PFM GO:0005622|"GO:intracellular"|PF00318|IPR001865| GO:PFM GO:0005840|"GO:ribosome"|PF00318|IPR001865| GO:PFM GO:0006412|"GO:translation"|PF00318|IPR001865| RP:SCP:NREP 1 RP:SCP:REP 5->235|1fjgB|4e-92|45.9|231/237|c.23.15.1| HM:SCP:REP 5->241|1fjgB_|5.2e-92|53.2|237/0|c.23.15.1|1/1|Ribosomal protein S2| OP:NHOMO 1038 OP:NHOMOORG 1026 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ------1-----11111111111111111111111111111111111111111111111-1111111111111111111111111111-11-1-11---111-111-1--2-11-2---1--1--1-2-341-1----1-----------------1-1---1111-1-----112---------111-1-1------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 247 STR:RPRED 100.0 SQ:SECSTR cTcccHHHHHTccccccccccccGGGGGGEEEEETTEEEEcHHHHHHHTHHHHHHcHHHHTTTccEEEEcccTTTHHHHHHHHHHHTcEEccccccccccccHHHHHHHHHHHHHHHHcTTcTTTTTccHHHHHHHHHHHHHHTTcTTcTTcccccccEEEEccTTTTHHHHHHHHTTTccEEEccccccccccccEEcccccccHHHHHHHHHHHHHHHHHTcccccccccccccGGGGcEEEccc DISOP:02AL 225-238,247-248| PSIPRED ccccHHHHHHcccccccccccccccccEEEEEEEccEEEEcHHHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHcccEEcccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHccccEEEEEccccccccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcc //