[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08327.1
DDBJ      :             outer membrane chaperone Skp (OmpH)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  122/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.48.1
:177 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   56->168 1sg2C PDBj 1e-07 32.7 %
:RPS:SCOP  37->170 1sg2A  f.48.1.1 * 1e-20 26.7 %
:HMM:SCOP  29->171 1u2mA_ f.48.1.1 * 1.5e-34 41.6 %
:RPS:PFM   37->170 PF03938 * OmpH 1e-07 29.9 %
:HMM:PFM   16->171 PF03938 * OmpH 3.6e-33 25.0 156/158  
:BLT:SWISS 37->168 SKP_YEREN 3e-12 28.0 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08327.1 GT:GENE ABF08327.1 GT:PRODUCT outer membrane chaperone Skp (OmpH) GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1566597..1567130 GB:FROM 1566597 GB:TO 1567130 GB:DIRECTION + GB:PRODUCT outer membrane chaperone Skp (OmpH) GB:PROTEIN_ID ABF08327.1 GB:DB_XREF GI:93354238 InterPro:IPR005632 LENGTH 177 SQ:AASEQ MKIYTPLAKSLSAAALAAAALCAAAPAMAQEARIAAVNSERILRDSQPAKAAQVKLEQEFSKRDRELQDMAQKIKAMADKLDKDTAVLADSDRQRRQREVADLDREFQRKQREFREDLNQRRNEELAQVLERANRVIRQIAEQRKYDLIVQEAVYVNPRIDITDDVMKALNAGSTGK GT:EXON 1|1-177:0| BL:SWS:NREP 1 BL:SWS:REP 37->168|SKP_YEREN|3e-12|28.0|132/164| COIL:NAA 30 COIL:NSEG 1 COIL:REGION 54->83| TM:NTM 1 TM:REGION 9->30| SEG 7->36|lakslsaaalaaaalcaaapamaqeariaa| SEG 105->116|refqrkqrefre| BL:PDB:NREP 1 BL:PDB:REP 56->168|1sg2C|1e-07|32.7|110/142| RP:PFM:NREP 1 RP:PFM:REP 37->170|PF03938|1e-07|29.9|134/158|OmpH| HM:PFM:NREP 1 HM:PFM:REP 16->171|PF03938|3.6e-33|25.0|156/158|OmpH| GO:PFM:NREP 1 GO:PFM GO:0005515|"GO:protein binding"|PF03938|IPR005632| RP:SCP:NREP 1 RP:SCP:REP 37->170|1sg2A|1e-20|26.7|131/141|f.48.1.1| HM:SCP:REP 29->171|1u2mA_|1.5e-34|41.6|137/143|f.48.1.1|1/1|OmpH-like| OP:NHOMO 126 OP:NHOMOORG 124 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111112111111112111111111111111--------------1------------------------------------------11--1---------111111111111111111---1--1------------1---------------------------------11-------------------1---------111111111111---------11111-1-------------------------------------------------------1111------------------------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 110 STR:RPRED 62.1 SQ:SECSTR #######################################################HHHHHHHHHHHHHHHHHHHHHHHHHHT###TccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccEEEEGGcccccTcccHHHHHH######### DISOP:02AL 1-1,51-54,56-59,81-98,103-120,173-178| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEHHHHccccccccHHHHHHcccccccc //