[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08349.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08349.1 GT:GENE ABF08349.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1587051..1587326 GB:FROM 1587051 GB:TO 1587326 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF08349.1 GB:DB_XREF GI:93354260 LENGTH 91 SQ:AASEQ MARSPHPKKEVEEALRHAEGQGWRVEVGGSHAWGRIYCPYNDEECRCGEFCITSVWSTPKNPGNHARALRRVVDNCTTHRKQHEADDGSKE GT:EXON 1|1-91:0| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------1--------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------1-----------------------------------------------------------------------------------------1-------1------------11---------11-----------------------------------------------------------------------------------------------------------------------1------------1------------------------------------------------------------------------------------------------1-------------------------------11--1--------------------------------11----1------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13,79-92| PSIPRED cccccccHHHHHHHHHHcccccEEEEEccccccEEEEcccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccccc //