[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08353.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.56.1
:455 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   152->362 3bl5E PDBj 3e-05 16.0 %
:RPS:PDB   336->373 2ckjC PDBj 5e-04 25.0 %
:RPS:SCOP  335->423 1dgjA1  a.56.1.1 * 2e-10 24.1 %
:HMM:PFM   335->361 PF01799 * Fer2_2 9.2e-05 37.0 27/75  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08353.1 GT:GENE ABF08353.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1589138..1590505) GB:FROM 1589138 GB:TO 1590505 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF08353.1 GB:DB_XREF GI:93354264 LENGTH 455 SQ:AASEQ MKRQLLVGRFGPDDRLDVTAGADEQTTYLQLVAGEKSLDHGISGALTSLKKIGVFPSEIGIDLLVLAAHVHAADTRISRTEQSQDSWTREIRLVVPVSDPTRWGAAAPTLKRSLDFLTGDRWTIGFRARPDRFTTITQVAPPSLIAPPFDSVSLFSGGLDSLIGAIDLLEDGATPLLVSHFGEGATSDAQGKLFAGLKKYYIQSSFERLRVGMTFKKGLVADVGSEDSTRGRSFLFFALGVFAGTGLGRRFVLRVPENGLIALNVPLDPLRLGSNSTRTTHPYYMARWNDLLIALDIDGEIRNPYWDKTKGEMAAACRNPDLLKKLATDSLSCSSPAKARWLGHGIEQCGYCLPCLIRRAALTAAWGAGNDPTTYTVPDLHAQPLDTRQATGVQVRSFQYAIERLKGKPQLANLLIHKPGSLVDEAAHLDQLADVYRRGLDEVARLIDGAEARPS GT:EXON 1|1-455:0| SEG 63->73|llvlaahvhaa| RP:PDB:NREP 2 RP:PDB:REP 152->362|3bl5E|3e-05|16.0|188/199| RP:PDB:REP 336->373|2ckjC|5e-04|25.0|36/1283| HM:PFM:NREP 1 HM:PFM:REP 335->361|PF01799|9.2e-05|37.0|27/75|Fer2_2| RP:SCP:NREP 1 RP:SCP:REP 335->423|1dgjA1|2e-10|24.1|87/113|a.56.1.1| OP:NHOMO 39 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- ---------------------1---------1---------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------1------------------1-----------------------------------------------------------------------------------------------------------------------------1------------------------1-----------1-------------------------1----211------------111------------------------------------------------------------------11-1----------------------2------------------1------------------1------------------------1----1------------------------------------------------1-------------1---------1---------1---1--------------1--------1------------------------------------------------------------------1----------11--1-----------------1-----------------------------------1---------------1--------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 270 STR:RPRED 59.3 SQ:SECSTR ################################################################################################HHcGGGGGGTcTTEEEEccccTTcEEEEEETTcccEEEEEccccTTTEE######EEEccccHHHHHEHHHHHHHHccEEEEEEEEcccTTcHHHHHHHHHHHHTHcccEEEEEccGGGGGcTGGGcccccTTHHHHHHHHHHHHHHHHHHTccEEE#HHHHTccEEEccccccccTTccGGGcHHHHHHHHHHHHHHHTcccEEEcTTTTccHHHHHHHHHHTTcHHHHHHHcccccccccHHHccccTTcccccHHHHHHHHHHHHHHHHccccc################################################################################## DISOP:02AL 1-2,7-7,76-87,224-226,452-456| PSIPRED cccEEEEccccccccEEccccccccccccHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHcccccccccccccEEEEccccHHHHHHHHHHHHccccEEEHHHHHHcHHHHHHHHHHHHHHHHHHcccHHHccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHcccHHHHHHcccccccccccHHcccccccccccHHHHHHHHHHHHHHcccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccc //