[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08358.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:116 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->114 PF11171 * DUF2958 1e-37 74.3 %
:HMM:PFM   5->115 PF11171 * DUF2958 1.9e-50 64.9 111/112  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08358.1 GT:GENE ABF08358.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1595652..1596002 GB:FROM 1595652 GB:TO 1596002 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF08358.1 GB:DB_XREF GI:93354269 LENGTH 116 SQ:AASEQ MINALITDEQRIVLLANGRESLQNPDFDPAPVVKLFTPDAGATWLLTEIDPDDHDHAFGLCDLGLGEPEVGWVSLGELATVRGGLGLPIERDLSFRAEKRLSAYARDARLAGRVIV GT:EXON 1|1-116:0| RP:PFM:NREP 1 RP:PFM:REP 5->114|PF11171|1e-37|74.3|109/111|DUF2958| HM:PFM:NREP 1 HM:PFM:REP 5->115|PF11171|1.9e-50|64.9|111/112|DUF2958| OP:NHOMO 59 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------1--------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------2-12---------------1-1-121---11---------------1-----1-------------------------------------------------------12-----3-----------11------1-------5---21--22441--3-----------------------------------------------------------------------------------------------------1----------------1------------------------------------------------------------------------------------------------------------------------------------1--21--------------------------------------1------------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccccccHHHHHHHHHHHHHHHHccccccccEEEEEcccccEEEEEEEEcccccccEEEEEEcccccccEEEEEHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHcccccc //