[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08362.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:340 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   159->218 1jn5B PDBj 2e-04 32.8 %
:BLT:SWISS 159->218 NXF1_BOVIN 6e-04 34.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08362.1 GT:GENE ABF08362.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1599888..1600910) GB:FROM 1599888 GB:TO 1600910 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF08362.1 GB:DB_XREF GI:93354273 LENGTH 340 SQ:AASEQ MPYLIMPWEHIAPGYHRGTILLGNGASIAVSSSFGYGSLLDHAQQAGLLADDVQQLFRSFGTSDFELILRLVWQASNVNRSLQIPDDRTHQAYLNVRECLIQAVRGVHPAYDLVSGHLPSMYQFLKGFDTVLSLNYDLLVYWTMTYGLNVQDDHVFKDCFVWNGMFDDAWGRFREPLRERTNTLVFYPHGSLALCRNVVEQEFKIHNAGEGLLEAILAEWRSERVVPLFVSEGTMSQKVSSIQNSYYLSTVYREVLTSQRFTLTLFGWGLGEHDRHLLRRMRGTGIQRVAVSVFRGDQVYCNYAYQVIQDDLGPVHVDFFDSESPGCWIHAVPPALPVFG GT:EXON 1|1-340:0| BL:SWS:NREP 1 BL:SWS:REP 159->218|NXF1_BOVIN|6e-04|34.5|58/620| BL:PDB:NREP 1 BL:PDB:REP 159->218|1jn5B|2e-04|32.8|58/182| OP:NHOMO 35 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1-11-----------------1---1----------------------------1---------------------------------------------------1-------------1-------1--------1------1----------------1----------------1------------1--------------1-------------------------------1------1-------------1--1---------1--------------------------1---------------------------------------------------------------2-------------------------------------1111-1111------------------------------1-------------------1-------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 58 STR:RPRED 17.1 SQ:SECSTR ##############################################################################################################################################################EEEEEEEEEEccGGGTTcEEEEEEEEEEEEcTTccEE##EEEEEEEEEEccHHHHHHHHc########################################################################################################################## DISOP:02AL 1-1| PSIPRED cccccccHHHHcccccccEEEEcccEEEEEEcccccHHHHHHHHHcccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHcccHHccHHHccccccccccccccccccccccccccEEEEcccccEEEEccccccEEEEHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHcccHHHHHHHHHHHHccccEEEEEEEEcccHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHccccccEEEEEccccccEEEEcccccccccc //