[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08366.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:263 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   179->245 PF10074 * DUF2285 7e-18 76.1 %
:HMM:PFM   132->247 PF10074 * DUF2285 8.2e-34 60.8 102/106  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08366.1 GT:GENE ABF08366.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1603648..1604439 GB:FROM 1603648 GB:TO 1604439 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF08366.1 GB:DB_XREF GI:93354277 LENGTH 263 SQ:AASEQ MVNPHHVAHWYPTAAYLYILGLDMLALAWEYLRRHPDYRLDWLRHRRRSQAAQHAALRWGLRLLEDPALDARDAHPAWLPGNAAVVQLHPDPDPPPDAAVFAFWRIPGHKQLLHDGKGLALIARSPGHCSRLALAPGLEDGMAVVHAHRGSGGGGAAAPARGHALVRDAALAHAMPRPPPAALLELHTLQALDATLAGASLREVGEGLFGADAVADWYSDGGLRSKVRRLVRRGDALMRGGYRRLAQLPPLEKGRFDKDAKRP GT:EXON 1|1-263:0| SEG 43->58|lrhrrrsqaaqhaalr| SEG 90->97|pdpdpppd| SEG 143->167|avvhahrgsggggaaaparghalvr| RP:PFM:NREP 1 RP:PFM:REP 179->245|PF10074|7e-18|76.1|67/106|DUF2285| HM:PFM:NREP 1 HM:PFM:REP 132->247|PF10074|8.2e-34|60.8|102/106|DUF2285| OP:NHOMO 28 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----2-----1-----11------1-------3---11--12221--------------------------------------------------------------------------------------------------------1----------------1---------1--------------------------------------------------------------------------------------------------------------------------1--11--------------------------------------1------------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,154-154,256-264| PSIPRED ccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEcccccccccHHHHHHHcccccHHHHHcccEEEEEEccccHHHHHHHccccHHHHHHHHHccccccccccccccccHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc //