Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08367.1
DDBJ      :             conserved hypothetical protein

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:108 amino acids
:HMM:SCOP  36->102 1j9iA_ a.6.1.5 * 3.7e-08 24.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08367.1 GT:GENE ABF08367.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1604478..1604804 GB:FROM 1604478 GB:TO 1604804 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF08367.1 GB:DB_XREF GI:93354278 LENGTH 108 SQ:AASEQ MRCVAGALKAMEVLTMRPAPLRPAAAPATTTAQPQRYLTNDEAADYLRLSPRTLEKQRVLGGGPRFRKFGRRVMYAVADLDAWAAERSFESTSDPEYAEQHSADSRAR GT:EXON 1|1-108:0| SEG 17->36|rpaplrpaaapatttaqpqr| SEG 61->72|gggprfrkfgrr| HM:SCP:REP 36->102|1j9iA_|3.7e-08|24.2|66/68|a.6.1.5|1/1|Putative DNA-binding domain| OP:NHOMO 26 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----2-----1-----11------1-------3---11--12211--1-----------------------------------------------------------------------------------------------------1----------------1---------1--------------------------------------------------------------------------------------------------------------------------1---1--------------------------------------1------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,88-109| PSIPRED ccHHHHHHHHHHEEEccccccccccccccccccHHHHcccHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccc //