[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08397.1
DDBJ      :             phosphoglycolate phosphatase
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  529/915 : Eukaryota  9/199 : Viruses  1/175   --->[See Alignment]
c.108.1
:243 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->197 2yy6A PDBj 4e-22 38.5 %
:RPS:PDB   2->218 3d6jA PDBj 5e-27 25.4 %
:RPS:SCOP  2->220 2hszA1  c.108.1.6 * 4e-45 27.9 %
:HMM:SCOP  3->222 1fezA_ c.108.1.3 * 1.9e-54 38.4 %
:RPS:PFM   4->186 PF00702 * Hydrolase 2e-09 27.9 %
:HMM:PFM   4->187 PF00702 * Hydrolase 1.3e-30 32.6 178/192  
:BLT:SWISS 5->218 GPH1_PSEAE 8e-29 37.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08397.1 GT:GENE ABF08397.1 GT:PRODUCT phosphoglycolate phosphatase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1636111..1636842 GB:FROM 1636111 GB:TO 1636842 GB:DIRECTION + GB:PRODUCT phosphoglycolate phosphatase GB:PROTEIN_ID ABF08397.1 GB:DB_XREF GI:93354308 InterPro:IPR005833 InterPro:IPR005834 InterPro:IPR006346 InterPro:IPR006402 InterPro:IPR006439 LENGTH 243 SQ:AASEQ MRYDIVSFDLDGTLVDTAAEIAEAANRALESHGIARRPVSEVTVLIGAGTRELMLKLLARVMIEQPHLADRVHPDQVLASMDEHYAVTTGTSSVPYPGALEALSALKAAGIKLACVTNKEFRHAERVLRVHRLDAYFDLVVGGDSLRVKKPDPGVLRHVVERLGGSTDRTGHVGDSRVDVEAARNAGVTAWAVPYGYNAGQPIEDAYPERLFPSLADLAQHVLAGRSGAPCVSLTSTQPTISS GT:EXON 1|1-243:0| BL:SWS:NREP 1 BL:SWS:REP 5->218|GPH1_PSEAE|8e-29|37.4|211/272| SEG 18->30|aaeiaeaanrale| BL:PDB:NREP 1 BL:PDB:REP 5->197|2yy6A|4e-22|38.5|182/206| RP:PDB:NREP 1 RP:PDB:REP 2->218|3d6jA|5e-27|25.4|205/206| RP:PFM:NREP 1 RP:PFM:REP 4->186|PF00702|2e-09|27.9|183/195|Hydrolase| HM:PFM:NREP 1 HM:PFM:REP 4->187|PF00702|1.3e-30|32.6|178/192|Hydrolase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00702|IPR005834| GO:PFM GO:0008152|"GO:metabolic process"|PF00702|IPR005834| RP:SCP:NREP 1 RP:SCP:REP 2->220|2hszA1|4e-45|27.9|219/224|c.108.1.6| HM:SCP:REP 3->222|1fezA_|1.9e-54|38.4|219/256|c.108.1.3|1/1|HAD-like| OP:NHOMO 804 OP:NHOMOORG 551 OP:PATTERN -------------1----111-1----------------------311-12-1----1---------- 112------------------1--11-------111-11------------1-----1----1-----11------1111232111111122-1-------1-----------------------11111-11111111-----1--1-------11---------21111------------1----------------1----1---11---1--2111--111111111--11111111111111-----1-11--1-----1----------111-----------------------------------11111111-----1----------21------1-111-1111---11---1-111---1-1-1221-----313231211111111111111111-1-211312111-211111112111122212323233322111111111221--22------------------------------12112333331111112111122441111111153343-11125332234332132231231122-1111111222121-112-2-1-1--121-1112112-2221---------------------212212211324212-123122132221223122223--12123------11231111111111111-111111111111111111111111221111111111111111121111111--111111111111---211111-1--1132211111111111111133333322223-3333523434444322211111111121111111111121123221222221111212--------11----111---------------------------1---2-222-12 -----------2-----------------------1-------------1-------------------------------------------------------------1----------------------------------------------1----1-------------1-----1----1---------- --1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 226 STR:RPRED 93.0 SQ:SECSTR ccccEEEEcccTTTEEcHHHHHHHHHHHHHHTTccccccHHHHTTTTccHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHHHGGGcEEcTTHHHHHHHHHHHTcEEEEEccccHHHHHHHHHTccTTGcccEEEcGGGccccTTcTHHHHHHHHHTTccGGGEEEEEccHHHHHHHHHHTcEEEEETTccccTTGGGGccccEEEccGGGGHHHHcccc################# DISOP:02AL 240-244| PSIPRED ccccEEEEEcccccHHcHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHcccccHHHcccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccEEEEEccccHHHHHHHHHHcccHHHccEEEEcHHcccccccHHHHHHHHHHccccHHHEEEEEccHHHHHHHHHcccEEEEEccccccHHHHHHccccEEEccHHHHHHHHHcccccccccccccccccccc //