[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08407.1
DDBJ      :             NADH ubiquinone oxidoreductase, 20 kDa subunit
Swiss-Prot:HOXY_RALEH   RecName: Full=NAD-reducing hydrogenase hoxS subunit delta;         EC=1.12.1.2;

Homologs  Archaea  26/68 : Bacteria  80/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
e.19.1
:209 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   30->203 1e3dA PDBj 2e-12 20.1 %
:RPS:SCOP  30->197 1cc1S  e.19.1.1 * 6e-19 25.0 %
:HMM:SCOP  29->197 1cc1S_ e.19.1.1 * 5.7e-32 35.5 %
:HMM:PFM   41->192 PF01058 * Oxidored_q6 5.4e-32 38.8 121/131  
:BLT:SWISS 1->209 HOXY_RALEH e-116 92.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08407.1 GT:GENE ABF08407.1 GT:PRODUCT NADH ubiquinone oxidoreductase, 20 kDa subunit GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1646529..1647158 GB:FROM 1646529 GB:TO 1647158 GB:DIRECTION + GB:PRODUCT NADH ubiquinone oxidoreductase, 20 kDa subunit GB:PROTEIN_ID ABF08407.1 GB:DB_XREF GI:93354318 InterPro:IPR006137 LENGTH 209 SQ:AASEQ MSTAAKNELASHELPATPMDPALAANREGKIKVSMIGLCGCWGCTLSFLDMDERLLPLLEKITILRSSLTDIKRIPERCAIGFVEGGVANEENIETLEHFRENCDILISVGACAVWGGVPAMRNVVELKDCLAEAYVNSATAVAGAKAVIPFHPDIPRITTKVYPCHEVVKMDYFIPGCPPDGDAIFKVLDDLVNGRPFDLPSSINRYD GT:EXON 1|1-209:0| SW:ID HOXY_RALEH SW:DE RecName: Full=NAD-reducing hydrogenase hoxS subunit delta; EC=1.12.1.2; SW:GN Name=hoxY; OrderedLocusNames=PHG090; SW:KW 2Fe-2S; 3Fe-4S; 4Fe-4S; Complete proteome; Cytoplasm;Direct protein sequencing; Iron; Iron-sulfur; Metal-binding; NAD;Oxidoreductase; Plasmid. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->209|HOXY_RALEH|e-116|92.8|209/209| GO:SWS:NREP 8 GO:SWS GO:0051537|"GO:2 iron, 2 sulfur cluster binding"|2Fe-2S| GO:SWS GO:0051538|"GO:3 iron, 4 sulfur cluster binding"|3Fe-4S| GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| RP:PDB:NREP 1 RP:PDB:REP 30->203|1e3dA|2e-12|20.1|144/262| HM:PFM:NREP 1 HM:PFM:REP 41->192|PF01058|5.4e-32|38.8|121/131|Oxidored_q6| RP:SCP:NREP 1 RP:SCP:REP 30->197|1cc1S|6e-19|25.0|140/275|e.19.1.1| HM:SCP:REP 29->197|1cc1S_|5.7e-32|35.5|141/278|e.19.1.1|1/1|HydA/Nqo6-like| OP:NHOMO 138 OP:NHOMOORG 106 OP:PATTERN -----------------------1-----2--111223332231111---11121---122---2--- --1-----------------------------1-----1---1-------------------------------------1----1---------------------------------------111111--11111111111--1111111--11------11--11-------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------2----------11---------------------------------------------------------------------------1-----------------------------------------------------------------1--11-----1-------1----11--------------1-11-11-21---------2122221--11-1--15-------------------------11----------1----------------------------------------------------------------------------------------------------------------------------11111-1--------------------------------------------------------------------------------------1------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 153 STR:RPRED 73.2 SQ:SECSTR #############################ccEEEEEEcccccHHHHHHHTccTTcHHHHHHTTcEEEcTTHHHHTcccccEEEEEccEEcTGGHHHHHHHGGGccEEEEEcHHHHHcGGGGcTTccccEEcHH##############cTTcEEc#######HHHHHGGGTcccEEEccccccHHHHHHHHHHHHTTccccccT###### DISOP:02AL 1-6,8-10,207-210| PSIPRED ccccccccHHHccccccccHHHccHHHcccccEEEEEcccccHHHHHHHHcccHHHHHHccccEEHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHcccEEEEEEcccccccHHHHcccccHHHHHHHHHHcccccccccccccccccccccccccccccHHcccccEEcccccccHHHHHHHHHHHHccccccccccccccc //