[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08443.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   6->62 PF10038 * DUF2274 2e-11 64.9 %
:HMM:PFM   6->71 PF10038 * DUF2274 8.8e-29 54.5 66/69  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08443.1 GT:GENE ABF08443.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1682185..1682445 GB:FROM 1682185 GB:TO 1682445 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF08443.1 GB:DB_XREF GI:93354354 LENGTH 86 SQ:AASEQ MSTARKLRLGPLPSSGSTKLTFTCPASLKADLDAYAALHAQAYGEAVDATTLIPHMLEAFIAGDRGFRRGRGDDTRSSSRTAAPKG GT:EXON 1|1-86:0| SEG 63->81|gdrgfrrgrgddtrsssrt| RP:PFM:NREP 1 RP:PFM:REP 6->62|PF10038|2e-11|64.9|57/69|DUF2274| HM:PFM:NREP 1 HM:PFM:REP 6->71|PF10038|8.8e-29|54.5|66/69|DUF2274| OP:NHOMO 25 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------1----2-----1-----11------1-------2---11--12221--------------------------------------------------------------------------------------------------------1----------------1------------------------------------------------------------------------------------------------------------------------------------1---1--------------------------------------1------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,70-87| PSIPRED ccHHHHcccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc //