[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08447.1
DDBJ      :             Integrase, catalytic region
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  531/915 : Eukaryota  3/199 : Viruses  3/175   --->[See Alignment]
c.55.3
:278 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   118->256 1cxuA PDBj 5e-19 19.9 %
:RPS:SCOP  118->273 1b92A  c.55.3.2 * 3e-19 11.6 %
:HMM:SCOP  111->280 1c0mA2 c.55.3.2 * 2.6e-36 31.1 %
:RPS:PFM   117->228 PF00665 * rve 8e-09 29.7 %
:HMM:PFM   115->231 PF00665 * rve 7.9e-27 30.8 117/120  
:HMM:PFM   20->84 PF01385 * Transposase_2 0.00045 16.9 65/227  
:BLT:SWISS 3->277 INSK_ECOLI 2e-95 57.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08447.1 GT:GENE ABF08447.1 GT:PRODUCT Integrase, catalytic region GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1685010..1685846 GB:FROM 1685010 GB:TO 1685846 GB:DIRECTION + GB:PRODUCT Integrase, catalytic region GB:PROTEIN_ID ABF08447.1 GB:DB_XREF GI:93354358 InterPro:IPR001584 LENGTH 278 SQ:AASEQ MLELRQHYDLAALLKVAGLSRSTFYYQAKVIGAGDRYADLKARIQSIYDHHKGRYGYRRITAALRRSGETINHKVVQRLMQSLGLRSLVRPKKYRSYRGPGHVSVPNLLQRQFQARRPNEKWVTDVTEFNVGGDKLYLSPVMDLYNGEIVAYQTSRRPHFSLVGTMLRKALNKLSSAQRPLLHSDQGWQYQMPAYRRVLAEHGVTKSMSRRGNCLDNAAMESFFGTLKSECFYLSKFTAIDQLQDALRRYIHYYNHHRIRTKLKGLSPVQYRTQPSMA GT:EXON 1|1-278:0| BL:SWS:NREP 1 BL:SWS:REP 3->277|INSK_ECOLI|2e-95|57.8|275/283| RP:PDB:NREP 1 RP:PDB:REP 118->256|1cxuA|5e-19|19.9|136/143| RP:PFM:NREP 1 RP:PFM:REP 117->228|PF00665|8e-09|29.7|111/116|rve| HM:PFM:NREP 2 HM:PFM:REP 115->231|PF00665|7.9e-27|30.8|117/120|rve| HM:PFM:REP 20->84|PF01385|0.00045|16.9|65/227|Transposase_2| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF00665|IPR001584| GO:PFM GO:0015074|"GO:DNA integration"|PF00665|IPR001584| RP:SCP:NREP 1 RP:SCP:REP 118->273|1b92A|3e-19|11.6|138/144|c.55.3.2| HM:SCP:REP 111->280|1c0mA2|2.6e-36|31.1|161/0|c.55.3.2|1/1|Ribonuclease H-like| OP:NHOMO 4851 OP:NHOMOORG 537 OP:PATTERN -------------------------------------------------------------------- 3-HI-OCK543N-E1G122-2K--C8H5IIF-EAFA-4AA--163--4---1-1--3*---25---8112-4---97-1-47-----1--8---5-1----3-614-3----------------1---6332-4-3------81--91----------------1-3----------------5--1----174----56298BC786B-5992-941-39814-2--2-26122216----1212-2-2--4-71-E8-R-6132647-851942OlO561FBi9-751B18767354732312534576272--ILC-----17-41121111-8-S-AA---139I-2--242B421743--612---9-23BE---------1C3622-3-1--22222222225-643--1-D121--4432--6--22-5-1-E-2-12B74-WVWWWWWW2EFD2C---------------------1------------2------l411GA55****II555A6812-BF-11G-298K87D4612C--571311115-24-111-DN76-5-131224D---------26-13611---3-1----------------------E-2--2-J33B-84--31fAJABC-51181nAA736----27--------1144326NPD73D85D-O985B581*BQ5BCB5CB364A--71-3A21-32-48E-4-1G7*g*****--HGCE9GADC182--2------6--1431-FACD-15-13511-----51--5EAI6844C41-41-341-5A9E---------42---65645d1A25F3UDgEFGHN------A-11--B4----------17991----226----2-D--3-11--1-P-------1- -----------------------------------------------------------------------------------------------------------------------------------------------3--------------------------1-----------------3---------- ------------------------------------------------------------1-----------------------------------------------------------------------------------------1-----1------------------ STR:NPRED 172 STR:RPRED 61.9 SQ:SECSTR ######################################################################################################cccccTTTEEEcTTcTTcEEEEEEEEcGGGTTccEEEEEEETTTccEEEEEEccccHHHHHHHHHHHHHHHccHccccEEEEEccHHHHcHHHHHHHHHHTcEEEEEcTTcHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHcccccccHHHHHHHHHccH#### DISOP:02AL 1-4,34-36,277-279| PSIPRED cHHHHHHccHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHccccEEEcHHHEEEEHHHcccEEEEccccccccccccccccccHHccccEEcccccEEEEEEEEEEcccccEEEEEEEEccccEEEEEEEcccccHHHHHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHccccEEEccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHcccccHHHHHHHHccc //