[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08464.1
DDBJ      :             protein of unknown function DUF1289
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  59/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:83 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   29->81 PF06945 * DUF1289 1e-08 47.2 %
:HMM:PFM   28->78 PF06945 * DUF1289 1.5e-20 43.1 51/56  
:BLT:SWISS 29->81 YDHL_SHIFL 2e-05 40.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08464.1 GT:GENE ABF08464.1 GT:PRODUCT protein of unknown function DUF1289 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1702676..1702927) GB:FROM 1702676 GB:TO 1702927 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF1289 GB:PROTEIN_ID ABF08464.1 GB:DB_XREF GI:93354375 InterPro:IPR010710 LENGTH 83 SQ:AASEQ MPVNPSASLAPSATVDPDGQAKLSDRPDSPCIGICSTLFDEICQGCGRTAAEVSNWVFYSDEEKQVIWERITREGTARRFQPD GT:EXON 1|1-83:0| BL:SWS:NREP 1 BL:SWS:REP 29->81|YDHL_SHIFL|2e-05|40.4|52/79| RP:PFM:NREP 1 RP:PFM:REP 29->81|PF06945|1e-08|47.2|53/54|DUF1289| HM:PFM:NREP 1 HM:PFM:REP 28->78|PF06945|1.5e-20|43.1|51/56|DUF1289| OP:NHOMO 60 OP:NHOMOORG 60 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1------------------------------1111----1----1---------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,79-84| PSIPRED ccccccccccccccccccccHHHHcccccccEEEEEEccccHHHHccccHHHHHccccccHHHHHHHHHHHHHHHHHcccccc //