[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08491.1
DDBJ      :             FAD linked oxidase-like protein
Swiss-Prot:             

Homologs  Archaea  34/68 : Bacteria  531/915 : Eukaryota  179/199 : Viruses  0/175   --->[See Alignment]
d.145.1d.58.32
:468 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->222 2uuuC PDBj 2e-12 24.8 %
:RPS:PDB   7->465 3bw7A PDBj 2e-59 15.8 %
:RPS:SCOP  2->218 1ahuA2  d.145.1.1 * 2e-32 20.3 %
:RPS:SCOP  220->467 1f0xA1  d.58.32.2 * 6e-31 13.8 %
:HMM:SCOP  4->218 1f0xA2 d.145.1.1 * 1.8e-74 53.8 %
:HMM:SCOP  191->467 1f0xA1 d.58.32.2 * 4.3e-49 32.3 %
:RPS:PFM   44->180 PF01565 * FAD_binding_4 7e-17 39.0 %
:RPS:PFM   218->463 PF02913 * FAD-oxidase_C 2e-20 35.7 %
:HMM:PFM   217->464 PF02913 * FAD-oxidase_C 7.3e-51 30.7 241/249  
:HMM:PFM   42->179 PF01565 * FAD_binding_4 2.4e-42 47.1 136/138  
:BLT:SWISS 33->461 D2HDH_BOVIN 1e-73 38.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08491.1 GT:GENE ABF08491.1 GT:PRODUCT FAD linked oxidase-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1733873..1735279) GB:FROM 1733873 GB:TO 1735279 GB:DIRECTION - GB:PRODUCT FAD linked oxidase-like protein GB:PROTEIN_ID ABF08491.1 GB:DB_XREF GI:93354402 InterPro:IPR004113 InterPro:IPR006094 LENGTH 468 SQ:AASEQ MSNTPALLSELAAILDPAGLQTGDAIDTRFRKDWYAPLGNPPLAVVRPRTTADVAAILAACHRHGQPVVPQGGLTGLASAATPGQGEVVLSLERMRGVEEIDEQAGTMTVWAGTTLQAAQEAARAAGWLLAVDLGARGSCQIGGNIATNAGGNRVIRYGMMRDQVLGIEVVLADGTVLTSLNKMLKNNAGYDLRQVFVGSEGTLGVITRAVLRLAPLPSATQTALCALKSFDDVVRLLRHAQRALSGRVSAFEAMWADYYTLVTTRVPGVRAPLAAGHPFYVLVDLQGSDADADAAAFERMLEGAMESGLIVDAAVAASGKEAESFWKLRDAVAEFPQMWAPNAAFDVSLPIGSIGRFADALRSAILERWPSAELVNFGHVGDSNLHFSVHLPGVDAAAFPEAEIDAVAYAIVREFAGSVSAEHGIGIHKKPYLGNSRTPEELALMRTIKAALDPKGILNPGRVFDPA GT:EXON 1|1-468:0| BL:SWS:NREP 1 BL:SWS:REP 33->461|D2HDH_BOVIN|1e-73|38.4|422/544| SEG 116->131|lqaaqeaaraagwlla| SEG 142->153|iggniatnaggn| BL:PDB:NREP 1 BL:PDB:REP 10->222|2uuuC|2e-12|24.8|202/541| RP:PDB:NREP 1 RP:PDB:REP 7->465|3bw7A|2e-59|15.8|448/497| RP:PFM:NREP 2 RP:PFM:REP 44->180|PF01565|7e-17|39.0|136/139|FAD_binding_4| RP:PFM:REP 218->463|PF02913|2e-20|35.7|238/242|FAD-oxidase_C| HM:PFM:NREP 2 HM:PFM:REP 217->464|PF02913|7.3e-51|30.7|241/249|FAD-oxidase_C| HM:PFM:REP 42->179|PF01565|2.4e-42|47.1|136/138|FAD_binding_4| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01565|IPR006094| GO:PFM GO:0050660|"GO:FAD binding"|PF01565|IPR006094| GO:PFM GO:0003824|"GO:catalytic activity"|PF02913|IPR004113| GO:PFM GO:0050660|"GO:FAD binding"|PF02913|IPR004113| RP:SCP:NREP 2 RP:SCP:REP 2->218|1ahuA2|2e-32|20.3|217/268|d.145.1.1| RP:SCP:REP 220->467|1f0xA1|6e-31|13.8|224/237|d.58.32.2| HM:SCP:REP 4->218|1f0xA2|1.8e-74|53.8|212/0|d.145.1.1|1/1|FAD-binding domain| HM:SCP:REP 191->467|1f0xA1|4.3e-49|32.3|254/0|d.58.32.2|1/1|FAD-linked oxidases, C-terminal domain| OP:NHOMO 1874 OP:NHOMOORG 744 OP:PATTERN 11-1-132122222-2-12222133---1-22----------------12111--------2111-1- 112341-1111-2-22222-22223432333222222786132211-21111143211--1141445322---------1-1311111-----1--------1------1----------------1-1111111166633---132122222221111112222222222-1-----1----22233--131122222222222222253111122234413--------2------------------------1111----11--11------------------------------------------------------3-121111111212-122111121-1-1--2-461121--22--1--1-221311411111227542244464533333333335-3443374546315443337434766411144544563442222222242221325-----------------------------1136115444455575634455557745444475677761233354433634347225211-24111111122244412614243342444-212112222233324131--1111111122111211111111331---3-1-1-11------1--------------2222-------------1--1111111--111111111-1111111--1-----------------------------------------------1---------21334---------------11111112324-44443334233343222-------------111111--11122222222232222111-111111----------1--------------------------11---1---321 ----222-53--2422454353455543333333333433233233434446673334344423324334224243313324445312-47443323332322433-222522122121-122244-429L4-324-2--22221-2-322--2213145722222131222423222281212131-73312264532 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 468 STR:RPRED 100.0 SQ:SECSTR cHHHHHccHHHHHHHHTTcEEccHHHHHHTcccTTccccccccEEEccccHHHHHHHHHHHHHcTTcEEEEccccccccTTcccTTcEEEEGGGGGcccEEcTTccEEEEETTccHHHHHHHHHTTTEEEcccccccccccHHHHHTTccccTTHHHHccGGGcEEEEEEEETTccEEEGTTccEEccccHHHHHHHTTcTTccEEEEEEEEEEEEcccEEEEEEEEEccHHHHHHHHHHHcccccccccEEEEEEEEGGGHHHHccHHHTTccccHHHHHHHHHHHHHHTccEHHHHHHHHHHHHHTccccTTcEEEEEEEHHHHHTHHHHHHHHHHHTTcccccEEEEEGGGHHHHHHHccHcccTTTccccccEEEEEccEEEEEEEccccccTTcHHHHHHHHHHHHHHHHHTTcccEEcccccccHHHHHHHHcHHHHHHHHHHHHHHcTTccccGGGccccH DISOP:02AL 1-3,468-469| PSIPRED cccHHHHHHHHHHHHccccEEccHHHHHHHccccccccccccEEEEEcccHHHHHHHHHHHHHcccEEEEEcccccccccccccccEEEEEccccccEEEEEccccEEEEEcccEEHHHHHHHHcccEEEEEccccccccEEcccccccccccccccccccHHEEEEEEEEcccccEEEEccccccccccccHHHHHHccccccEEEEEEEEEEEEccccEEEEEEEEccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccc //