[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08495.1
DDBJ      :             Integrase, catalytic region
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  523/915 : Eukaryota  3/199 : Viruses  3/175   --->[See Alignment]
c.55.3
:297 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   130->268 1cxuA PDBj 2e-17 18.4 %
:RPS:SCOP  131->278 1b92A  c.55.3.2 * 7e-18 15.4 %
:HMM:SCOP  124->291 1c0mA2 c.55.3.2 * 8.6e-45 33.8 %
:RPS:PFM   131->241 PF00665 * rve 6e-08 30.0 %
:HMM:PFM   129->241 PF00665 * rve 2.9e-31 31.9 113/120  
:BLT:SWISS 1->285 INSF_ECOLI 2e-58 43.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08495.1 GT:GENE ABF08495.1 GT:PRODUCT Integrase, catalytic region GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1739334..1740227) GB:FROM 1739334 GB:TO 1740227 GB:DIRECTION - GB:PRODUCT Integrase, catalytic region GB:PROTEIN_ID ABF08495.1 GB:DB_XREF GI:93354406 InterPro:IPR001584 LENGTH 297 SQ:AASEQ MRYAFIERNRRYWPVSVLCELLGVSPSGYHQRKQRTVSTDRPDRGRLSDDALLAHIKAIHAGVKGEYGWPRMWKELLARGVRVGKERVRKLMALHGIRARHKRKYIATTNSNHDLPVAPNLLQRDFSPAAPNQVWTSDITYVATAEGWLYLVVIIDLFSRQVVGWSMQPHMKAELVTDALRMAWFRRRPEAGVIVHTDRGSQYCSHLFQDALKAYGMRSSMSRRGDCWDNAPTESLWGSLKVARLHGRQFATRRAAMDEVIDWLGFYNASRLHSTLGYVSPMTFEKNWSAAQQHRAA GT:EXON 1|1-297:0| BL:SWS:NREP 1 BL:SWS:REP 1->285|INSF_ECOLI|2e-58|43.7|279/288| SEG 79->90|rgvrvgkervrk| RP:PDB:NREP 1 RP:PDB:REP 130->268|1cxuA|2e-17|18.4|136/143| RP:PFM:NREP 1 RP:PFM:REP 131->241|PF00665|6e-08|30.0|110/116|rve| HM:PFM:NREP 1 HM:PFM:REP 129->241|PF00665|2.9e-31|31.9|113/120|rve| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF00665|IPR001584| GO:PFM GO:0015074|"GO:DNA integration"|PF00665|IPR001584| RP:SCP:NREP 1 RP:SCP:REP 131->278|1b92A|7e-18|15.4|130/144|c.55.3.2| HM:SCP:REP 124->291|1c0mA2|8.6e-45|33.8|160/0|c.55.3.2|1/1|Ribonuclease H-like| OP:NHOMO 4658 OP:NHOMOORG 529 OP:PATTERN -------------------------------------------------------------------- 1-HJ-PBN763N-E1G122-2Q--68H5IIF-FIKK14BL-1273--7---3-1-14*---26---A212-5---93-1-47-----1--F---B-1----3-61475--------------------643214-6------8-1-91----------------1-3----------------5--1----174----452768C686B-5992-741-39514-2--2-26121116----1211-2-2--3-5--E8-R-6-11637-851941OkO561CAi9-8412-4354343232413445455262--567-----17-41121111-8-R-BB---12AI-2--25-C421543--612---5-52CF---------1C33221--1-122332223232-822--12D111--444---2--1245-1-5-2-42B3-1EEEEEEEE256B2B---------------------1----------1-21-----k511JA56****HI567A7823-BF-22G-29AEB7Q4614C--68131-11-222-----DP79-5-13132-D---------35-B66-----56-----------------------D-2--2-J378-84--31oGOBBC-98B81nLA736----27--------1152226PRD63E86D-O975B581*7R5BBB5CB3534--81-381--31149E-4--G6*g*****--GC9B7CAAA16---6------5-11443-F798-15-112-1-----52--5BCI7845E41-41-341-5A9E---------42--965645d1A26D3MCbDD88F------A-----D4----------17981----223------C--3-11--3-8--------- -----------------------------------------------------------------------------------------------------------------------------------------------3--------------------------1-----------------2---------- ------------------------------------------------------------1-----------------------------------------------------------------------------------------1-----1------------------ STR:NPRED 178 STR:RPRED 59.9 SQ:SECSTR ####################################################################################################################ccccTTTcccccccTTcEEEEEEEEcGGGTTccEEEEEEETTTccEEEEEEccccHHHHHHHHHHHHHHHcccccccEEEEEccHHHHcHHHHHHHHHHTcEEEEEcTTcHHHHHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHcccTccccccccHHHHHHHHHHHHHT### DISOP:02AL 39-43,287-298| PSIPRED cHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHHcccEEEEccccccccccccccccccHHHcccccccccccEEEEEEEEEEcccccEEEEEEEEccccEEEEEEccccccHHHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHccccEEEccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccHHcccccHHHHHHHHHHHHHHccc //