[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08518.1
DDBJ      :             Uncharacterized protein UPF0065
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  230/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.288.1c.94.1e.26.1
:333 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->333 2qpqA PDBj 2e-65 41.9 %
:RPS:PDB   34->333 2dvzA PDBj 1e-72 38.5 %
:RPS:SCOP  2->91 1jqkA  e.26.1.2 * 3e-16 11.1 %
:RPS:SCOP  239->330 2o70A1  a.288.1.1 * 7e-23 14.1 %
:HMM:SCOP  121->302 1hslA_ c.94.1.1 * 1.3e-13 24.5 %
:RPS:PFM   54->328 PF03401 * Bug 4e-76 54.8 %
:HMM:PFM   55->329 PF03401 * Bug 1.8e-102 49.3 272/274  
:BLT:SWISS 9->325 YTCB_PSESQ 6e-73 43.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08518.1 GT:GENE ABF08518.1 GT:PRODUCT Uncharacterized protein UPF0065 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1763640..1764641) GB:FROM 1763640 GB:TO 1764641 GB:DIRECTION - GB:PRODUCT Uncharacterized protein UPF0065 GB:PROTEIN_ID ABF08518.1 GB:DB_XREF GI:93354429 InterPro:IPR005064 LENGTH 333 SQ:AASEQ MFFTHRRMRPMLAVLCAGCMTIATQAGAQSADHWPSKPITYVVPFAAGGTTDLLGRLIGQRLSQTLGQSIVVENRAGAGGNIGSDYVAKAAPDGYTLLGGTISSHAINISLYPKMPYDPVKNFQPVALIGTLPNVLVVNANSPWKSVQDVIAAAKAKPGSVNFGSSGNGTSQHLAAELFANMAGLRMTHVPYKGSSQAVQALLGNQVDIVFENSVAAMPMIQAGKFRALATTGAKRAPELPDVPTMAESAPGLSGYEIVSWQAIFAPAGTPMPIINKLSGEIGKIIRQPDVRSKLAAMGIEPSGAGPTELGNFQKSEVAKWANLIKVANIHLE GT:EXON 1|1-333:0| BL:SWS:NREP 1 BL:SWS:REP 9->325|YTCB_PSESQ|6e-73|43.8|313/336| BL:PDB:NREP 1 BL:PDB:REP 35->333|2qpqA|2e-65|41.9|296/296| RP:PDB:NREP 1 RP:PDB:REP 34->333|2dvzA|1e-72|38.5|291/292| RP:PFM:NREP 1 RP:PFM:REP 54->328|PF03401|4e-76|54.8|272/274|Bug| HM:PFM:NREP 1 HM:PFM:REP 55->329|PF03401|1.8e-102|49.3|272/274|Bug| GO:PFM:NREP 1 GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF03401|IPR005064| RP:SCP:NREP 2 RP:SCP:REP 2->91|1jqkA|3e-16|11.1|90/610|e.26.1.2| RP:SCP:REP 239->330|2o70A1|7e-23|14.1|92/165|a.288.1.1| HM:SCP:REP 121->302|1hslA_|1.3e-13|24.5|155/238|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 2352 OP:NHOMOORG 235 OP:PATTERN -------------------------------------------------------------------- --------111----------1---1-------111-1-1----1-------132-1-------212-111-----------1-----------------------------------------------------111--------------------------------------------41---11---111111-1--11111-5122-1111--114--------3--------------------------------------------------------------------------------------------5---------------------1----1----55-----1-------1---------------Z67--874986----------4-21111---F---14423396336562---6453-35414--------------1------------------------------1-----R****-------------1---------D****9G322K7tkj*f*3**5A1-----------------1----12-1-1----1----------1111-------1-----------------------11--1-----1-1111----11---------------------1111------1-111-------111-1--1-11-113-----11111111111111111111------------------------------------276---1-2--------1--------1-4-1121111-211111111----------1-111111111112--1--------------1------------------------------------------------4------ -------------1------------------------------------------------------------------------------------------------------------------------------------------------M--------------1-----------1--u---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 333 STR:RPRED 100.0 SQ:SECSTR cTTcccEEEccTTccHHHHHcHHHHHHHHHTTTcccccEEEEEcccTTcHHHHHHHHHHHHHHHHHTTccEEEEcccGGGHHHHHHHHHccTTccEEEEEcHHHHHHHHHcTTTccccTTTcEEEEEEEEEEcEEEEEcTTcccccHHHHHHHHHTcTTTcEEEEccTTcHHHHHHHHHHccHTcccEEEEcccHHHHHHHHHHTcccEEEcEEHHHHHHHHTTccEHEEEEcccccGGGTTcccTTTTccTcGGGcccEEEEEEEETTcccHHHHHHHHHHHHHHTcHHHHHHHHHHTEEEccccHHHHHHHHHHHHHHHHHHHHcTTcccc DISOP:02AL 1-5,333-334| PSIPRED ccccHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEccccccHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHcccccccEEEEEccHHHHHHHHHcccccccHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHccccEEEEccccHHHHHHHHHcccccEEEccHHHHHHHHHcccEEEEEEEcccccHHccccccHHHHccccccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHccHHHHHHHHHcccEEccccHHHHHHHHHHHHHHHHHHHHHcccccc //