[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08532.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  25/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.25.1
:206 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   45->199 2c2fA PDBj 2e-12 10.3 %
:RPS:SCOP  45->162 1z6oM1  a.25.1.1 * 2e-13 12.7 %
:RPS:SCOP  135->202 1zpyA1  a.25.1.5 * 4e-05 14.7 %
:HMM:SCOP  58->203 1vjxA_ a.25.1.1 * 6.7e-16 23.6 %
:HMM:PFM   104->165 PF00210 * Ferritin 1.4e-05 30.6 62/142  
:HMM:PFM   64->127 PF09537 * DUF2383 6.7e-05 20.6 63/111  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08532.1 GT:GENE ABF08532.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1783672..1784292 GB:FROM 1783672 GB:TO 1784292 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF08532.1 GB:DB_XREF GI:93354443 LENGTH 206 SQ:AASEQ MKTKPDLSLPFAGSACDADLAPDLVRRGWLKAPGAFALGSLAVMSLGEAMPAWGQTHSTSTKDDINILNTALGLEYQAIAAYQVGAESGLLQKPVLDTAVKFQTHHKAHADVLANTVMKLGGTPVKTRKASEYNFPAADLKTQADVLRFAAGLEKGATAAYLGVLPSFHNRELAKSAGSILGDEAMHWAILLSVLGEDPVPGAFVG GT:EXON 1|1-206:0| RP:PDB:NREP 1 RP:PDB:REP 45->199|2c2fA|2e-12|10.3|155/178| HM:PFM:NREP 2 HM:PFM:REP 104->165|PF00210|1.4e-05|30.6|62/142|Ferritin| HM:PFM:REP 64->127|PF09537|6.7e-05|20.6|63/111|DUF2383| RP:SCP:NREP 2 RP:SCP:REP 45->162|1z6oM1|2e-13|12.7|118/191|a.25.1.1| RP:SCP:REP 135->202|1zpyA1|4e-05|14.7|68/91|a.25.1.5| HM:SCP:REP 58->203|1vjxA_|6.7e-16|23.6|140/0|a.25.1.1|1/1|Ferritin-like| OP:NHOMO 29 OP:NHOMOORG 28 OP:PATTERN ---------------------------1---------------------------------------- ---------------------------------------------2------------------------------------1-----------------------------------------------------------------------------------1-------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111------------------------1111--111---11--111-1-1----------------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------1----------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 75.2 SQ:SECSTR ############################################cTTcTTcccTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccTTHHHHHHHHHHHHHHHTHHHHHHHHHHHHTTccccccHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHccTT####### DISOP:02AL 1-4| PSIPRED ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //