[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08536.1
DDBJ      :             monooxygenase, FAD-binding
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  7/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:404 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   263->401 3cuqB PDBj 2e-07 8.2 %
:RPS:SCOP  177->392 3c96A1  c.3.1.2 * 3e-06 14.0 %
:HMM:SCOP  35->395 1fohA5 c.3.1.2 * 7.9e-32 28.7 %
:RPS:PFM   269->338 PF05834 * Lycopene_cycl 3e-05 38.8 %
:HMM:PFM   177->345 PF01494 * FAD_binding_3 6.8e-10 24.7 166/356  
:HMM:PFM   45->201 PF07992 * Pyr_redox_2 2.6e-10 29.3 116/202  
:HMM:PFM   340->381 PF00825 * Ribonuclease_P 0.00066 33.3 42/111  
:BLT:SWISS 177->372 GGR_METJA 2e-13 30.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08536.1 GT:GENE ABF08536.1 GT:PRODUCT monooxygenase, FAD-binding GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1788170..1789384) GB:FROM 1788170 GB:TO 1789384 GB:DIRECTION - GB:PRODUCT monooxygenase, FAD-binding GB:PROTEIN_ID ABF08536.1 GB:DB_XREF GI:93354447 InterPro:IPR002938 InterPro:IPR003042 InterPro:IPR006076 InterPro:IPR013027 LENGTH 404 SQ:AASEQ MPSARHPPPFTFTSSCLHPRTGYSRPSNHQRGTEMATRTQDFDHDVVIVGASFAGAACALAAARAGLRVVVLERKTDPGSKLHTTGILVKEAAEQTWLGRAPADCLRRIEKVHLYSPALRSLALAAPGYYFLTTDTPNLMRWLASELVNHGVDLRLGTSFSQASRSGAGWSVPGVGRTRYLVGADGARSRVAQIAGLGQGNAFLYGVEYEFAGLQLSDPDALHCFASKHFAPGYIGWVAQNPTGVQAGLALRHAPRRRAAPDIDGFLRRVRHLLGVPEDAAPTTTRAGLIPCGGPVYPLARDGVLLTGDAAGIVSPVTAGGIHAAWRHGEAVGRAIAAHLRTGAATPEQVAEQSAPRFRTKRLLRWAFDHFQSDWAFDVLLHSAPLRWVAERIYFHKRGVAAEI GT:EXON 1|1-404:0| BL:SWS:NREP 1 BL:SWS:REP 177->372|GGR_METJA|2e-13|30.0|180/391| SEG 50->74|gasfagaacalaaaraglrvvvler| SEG 114->127|lyspalrslalaap| SEG 249->261|lalrhaprrraap| RP:PDB:NREP 1 RP:PDB:REP 263->401|3cuqB|2e-07|8.2|134/204| RP:PFM:NREP 1 RP:PFM:REP 269->338|PF05834|3e-05|38.8|67/368|Lycopene_cycl| HM:PFM:NREP 3 HM:PFM:REP 177->345|PF01494|6.8e-10|24.7|166/356|FAD_binding_3| HM:PFM:REP 45->201|PF07992|2.6e-10|29.3|116/202|Pyr_redox_2| HM:PFM:REP 340->381|PF00825|0.00066|33.3|42/111|Ribonuclease_P| GO:PFM:NREP 2 GO:PFM GO:0016117|"GO:carotenoid biosynthetic process"|PF05834|IPR008671| GO:PFM GO:0016705|"GO:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen"|PF05834|IPR008671| RP:SCP:NREP 1 RP:SCP:REP 177->392|3c96A1|3e-06|14.0|193/269|c.3.1.2| HM:SCP:REP 35->395|1fohA5|7.9e-32|28.7|258/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 23 OP:NHOMOORG 23 OP:PATTERN ----------------1----------------1111111111-----11----1---------1--- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------1-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 274 STR:RPRED 67.8 SQ:SECSTR ###############################################################################################################################cccEEEEEHHHHHHHHHHHHHHTTcEEEccccEEEEEEETTEEEEEETTEEEEEEEccGGGHHHGGGGTEEcccEEEEEEEEEEcccHHHHcGGGTccEEEEEETTEEEEEEcccTTccEEEEEccccEEccTTTcHHHHHHHHHHHHHHHHHHHHHHHHHHGGGcccccHHHHHHHHHHTcccHHHHTTcccccHHHHHHHHHHHHHHHHHHHHTTcEEEHHHTcccccccHHHHHHHHHTTTTTTccEEEEEcTTcccEEEEETTccGGGGH### DISOP:02AL 1-5,24-36,404-405| PSIPRED ccccccccccEEccccccccccccccccccHHHHHHHccccccccEEEEccccccHHHHHHHHccccEEEEEEcccccccccccccccccHHHcccccccccHHHEEcccEEEEEcHHHHHHHccccccEEEEEEHHHHHHHHHHHHHHcccEEEccEEEEEEEEcccEEEEEEEEEEEEEEEcccccHHHHHHccccccccEEEEEEEEEEccccccccEEEEEEcccccccEEEEEEEcccEEEEEEEEEccccccccccHHHHHHHHHHHcccccccEEEEEEEEEEcccccccccccccEEEEEccHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccc //