[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08549.1
DDBJ      :             Transposase and inactivated derivatives-like protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  131/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.55.3
:341 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   82->210 1cz9A PDBj 5e-10 18.6 %
:HMM:SCOP  82->193 1c0mA2 c.55.3.2 * 5.8e-05 20.4 %
:RPS:PFM   33->125 PF03050 * Transposase_25 8e-19 48.4 %
:HMM:PFM   21->126 PF03050 * Transposase_25 9.9e-14 22.6 106/178  
:HMM:PFM   80->184 PF00665 * rve 1.3e-10 21.9 105/120  
:BLT:SWISS 21->212 T431_STAAW 4e-32 37.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08549.1 GT:GENE ABF08549.1 GT:PRODUCT Transposase and inactivated derivatives-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1804904..1805929 GB:FROM 1804904 GB:TO 1805929 GB:DIRECTION + GB:PRODUCT Transposase and inactivated derivatives-like protein GB:PROTEIN_ID ABF08549.1 GB:DB_XREF GI:93354460 LENGTH 341 SQ:AASEQ MIKELPAGVAKVLKRLHHPLDVILLCVRWYVAYSLSLRDLEEMMAERGLAVDHSMVHRWVIKLLPLFEKAFRRHKRSVSKSWRMDETYLKVRGKWAYLYRAVDKAGNTIDFLLCARRDKVAARRYFEKAIGQNGAPDTVAIDKSAANLAALHAVNAHRETPIRIRQRKYLNNIVEQDHRAIKRRARPMLGFKNFRCARILIGGIETMHMIAKGRCGDPKAFACPPRSNSIPWFHRPAHSSPPASTNRPYRDRTKGAGAPAFGIQTPFDSSRGSLLLQWQARLMIFDALSPTSRFHSVPEAMHLGKVVVDRGFRRPQSSLRVDTASYRINLAGERHVSRTHQ GT:EXON 1|1-341:0| BL:SWS:NREP 1 BL:SWS:REP 21->212|T431_STAAW|4e-32|37.8|188/224| SEG 145->157|aanlaalhavnah| RP:PDB:NREP 1 RP:PDB:REP 82->210|1cz9A|5e-10|18.6|129/139| RP:PFM:NREP 1 RP:PFM:REP 33->125|PF03050|8e-19|48.4|93/160|Transposase_25| HM:PFM:NREP 2 HM:PFM:REP 21->126|PF03050|9.9e-14|22.6|106/178|Transposase_25| HM:PFM:REP 80->184|PF00665|1.3e-10|21.9|105/120|rve| HM:SCP:REP 82->193|1c0mA2|5.8e-05|20.4|108/0|c.55.3.2|1/1|Ribonuclease H-like| OP:NHOMO 467 OP:NHOMOORG 135 OP:PATTERN ---------------------------------------------------1---------------- --4---26445--4------------------------2--298-----------------------1----------------------------6-------------------------------------------------3-------------------1-----------------8--------------31-1--------------5-------9-------26214-12-5552-4-38788---24-1-------1-----1--C3-------------------------------------3244-------------------------------------------4---------------------1-3----------22212221224---6--F2-36--4--G---E-------131------1----------4-1---------------------------------6--41-------------71-1111-12125--------2------------31------------------------------------------------------------------------------------------------112------1-3--1---------------------------1-2------29---2---4------E1-----------A--3--3---A-----------121-11-1-12--2--------------1---------------3-3-3---------2------------------------1--B--------------4-----11------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------6--------------------------2-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 37.8 SQ:SECSTR #################################################################################EEEEEEEcGGGTTccEEEEEEETTTccEEEEEEccccHHHHHHHHHHHHHHHccccEEEEEccHHHHcHHHHHHHHHHTcEEEEEcTTHHHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHH################################################################################################################################### DISOP:02AL 1-10,238-252,335-342| PSIPRED ccccccccccHHcccccccHHHHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEccEEEEEEEEEcccccEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHccccccEEEEcccHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccccEEEEccEEEEEEcccHHHHHccc //