Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08554.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:107 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08554.1 GT:GENE ABF08554.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1809739..1810062 GB:FROM 1809739 GB:TO 1810062 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF08554.1 GB:DB_XREF GI:93354465 LENGTH 107 SQ:AASEQ MRGLHIDRRSGRIHMRNVRACVVDGVADGGAQAWTKHGFKSPPSIGGQLAIDFAWTARALTFRAMPSMHSDGNGGRVTRGSGVAHPISDVSGLNAKREGSTDLPRRL GT:EXON 1|1-107:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,71-75,99-104,107-108| PSIPRED ccccEEcccccEEEEEEEEEEEEEccccccHHHHHHcccccccccccEEEEEEEEEEEEEEEEEcccccccccccEEEccccccccccccccccccccccccccccc //