[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08555.1
DDBJ      :             membrane protein-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  64/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:1093 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   192->514,981->1081 PF10101 * DUF2339 8e-52 46.7 %
:HMM:PFM   192->862 PF10101 * DUF2339 3.2e-174 42.9 645/745  
:HMM:PFM   874->1086 PF10101 * DUF2339 7.8e-42 38.5 205/745  
:BLT:SWISS 946->988 YEEO_ECOLI 8e-04 34.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08555.1 GT:GENE ABF08555.1 GT:PRODUCT membrane protein-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1810134..1813415 GB:FROM 1810134 GB:TO 1813415 GB:DIRECTION + GB:PRODUCT membrane protein-like protein GB:PROTEIN_ID ABF08555.1 GB:DB_XREF GI:93354466 InterPro:IPR001005 LENGTH 1093 SQ:AASEQ MLWILGLIGLIVGASVWGGEGAVVGAAVGAALGWVLRENAQQDALPVRKGEGPSLAQRVSALEREVAELKRALGAAGAGYANGAVDSETSDYSETVRSEVPERPPVIPVPASHSAVAATAVSAVPIPVAAAPGSAPAPMSRTQVVSHQDVPEIVPVSAASPRPASSSDMPFVVASDIDFAKHLFREALDWLLGGNSVARVGILILFFGVAFLLKYAADNSILPVEFRLAGVCLGAVGLLALGWRLRTRRPGYALAVQGAGVGVLYLTVFAAARLYDLLPAGAAFALMVLVCGLAAGLAILQNASVLAVTGSAGGFLAPVLISTGGGSHVMLFSYYALLNTGIFVIAWFRAWRVLNLLGFVFTFGIATLWGVLSYKPALLSTTEPFLILFFLLYTGIALLYALRRSVQLTGYVDGTLIFGTPLAMAGLQAALMRGTPFGMAWSAVAMAAFYFALAAGLLRHRQRLGLLFDALLALGVIFATLAIPLGFDGRTTCAVWALEGAGVVWIAMRQQRRLPLWCGLLLQFAAGFAFLAGALGDTEPGAWPVFNARYIGTMLLALAGFFSAWCLLAREQVRTWVPFVQEWGLMVALWGVWWWLGGGVFEIWHWHVEQGWSVQDLLRGWLLFAVLSAWLAHLGSRAADWPLAGFPALGLTPVQALLCIASCAVWTGPPLGGSGLLTWPLAFVASWWLLKRQEAAHADTWLAPLHTLLFLTLCVLLSDEGYWRLRAFVPEGAWSWAAWTFGHGCLLAVLAGAGLRLHWPVRRFARAYLLWAALPLAALLWIWSLASLVSDGAADPLPFVPFLNPLDVGQMLVIVALVLWRRRVLALELASQPRGLEYAALGTVFLWLNAVLLRTLHHHFGVRYAVPEILESLNLQLVFLAGWGAIVLAALWRVREPAVVRVAAFASAPLVLVMLLWSLYANLTQPGTLLGRIPLLNPLDLIMLLTFGAAVLWWLRAPVAGLPVDLHTRAAGALGAGIVLIWLNAVLLRTLHHWQGVPYTLHDLAGSTLVQASLSVFWTVLALLAMLVATRRAVRSLWLVGGGLLAVTVMKMFLVDLSFLSGVARIVSFIAVGGLLLLIGYLSPMPPAAKEGV GT:EXON 1|1-1093:0| BL:SWS:NREP 1 BL:SWS:REP 946->988|YEEO_ECOLI|8e-04|34.9|43/100| TM:NTM 31 TM:REGION 9->31| TM:REGION 196->218| TM:REGION 222->243| TM:REGION 252->274| TM:REGION 277->299| TM:REGION 304->326| TM:REGION 328->350| TM:REGION 354->376| TM:REGION 381->402| TM:REGION 409->431| TM:REGION 438->459| TM:REGION 464->485| TM:REGION 492->509| TM:REGION 518->540| TM:REGION 552->574| TM:REGION 584->606| TM:REGION 614->636| TM:REGION 644->666| TM:REGION 670->690| TM:REGION 703->724| TM:REGION 740->761| TM:REGION 770->792| TM:REGION 799->820| TM:REGION 835->857| TM:REGION 872->893| TM:REGION 899->921| TM:REGION 936->958| TM:REGION 971->993| TM:REGION 1009->1030| TM:REGION 1037->1059| TM:REGION 1065->1087| SEG 4->36|ilgliglivgasvwggegavvgaavgaalgwvl| SEG 72->84|algaagagyanga| SEG 96->138|vrsevperppvipvpashsavaatavsavpipvaaapgsapap| SEG 154->167|vpvsaasprpasss| SEG 227->246|rlagvclgavgllalgwrlr| SEG 440->475|awsavamaafyfalaagllrhrqrlgllfdallalg| SEG 519->536|glllqfaagfaflagalg| SEG 583->600|wglmvalwgvwwwlgggv| SEG 666->681|wtgpplggsglltwpl| SEG 700->717|twlaplhtllfltlcvll| SEG 744->757|gcllavlagaglrl| SEG 765->790|arayllwaalplaallwiwslaslvs| SEG 812->830|lvivalvlwrrrvlalela| SEG 893->906|rvrepavvrvaafa| SEG 933->945|ipllnpldlimll| SEG 970->977|aagalgag| SEG 1019->1035|tvlallamlvatrravr| RP:PFM:NREP 1 RP:PFM:REP 192->514,981->1081|PF10101|8e-52|46.7|410/690|DUF2339| HM:PFM:NREP 2 HM:PFM:REP 192->862|PF10101|3.2e-174|42.9|645/745|DUF2339| HM:PFM:REP 874->1086|PF10101|7.8e-42|38.5|205/745|DUF2339| OP:NHOMO 65 OP:NHOMOORG 65 OP:PATTERN -------------------------------------------------------------------- -1----------------------------------------------------------------------------------------1--1------1-1--11--1---------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------11-------111111-----111-------11----1--111---------11--1-----------------1--1-1--1---------1-1-------------------------------------1---------------------------------------------11------------------------------------------------------------------------------------------------1-----------------------1-1--11111-1111-----11-------------------------1111111111---------1----------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 160-165,1088-1094| PSIPRED cHHHHHHHHHHHcHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHccccccccccccccccHHHHHHccccccccccccccccccccHHHcccccccccEEEcccccccccccccccEEEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHEEcccccccEEEEEHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHcccccHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccHHHEEccccccHHHHHHHHHHHHHHHHHcccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEHHcccHHHHHHHHHHHHHccccccccHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //