[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08563.1
DDBJ      :             major facilitator superfamily MFS_1
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  148/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:411 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->403 1pw4A_ f.38.1.1 * 6.9e-56 25.6 %
:HMM:PFM   22->361 PF07690 * MFS_1 3.3e-37 24.7 336/353  
:HMM:PFM   327->409 PF07690 * MFS_1 0.00056 20.7 82/353  
:BLT:SWISS 13->80,221->393 YBFB_BACSU 6e-10 23.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08563.1 GT:GENE ABF08563.1 GT:PRODUCT major facilitator superfamily MFS_1 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1819238..1820473 GB:FROM 1819238 GB:TO 1820473 GB:DIRECTION + GB:PRODUCT major facilitator superfamily MFS_1 GB:PROTEIN_ID ABF08563.1 GB:DB_XREF GI:93354474 InterPro:IPR007114 InterPro:IPR011701 LENGTH 411 SQ:AASEQ MSSRSSLRPVLPILIGASVMLSLAMGLRQSLGIFVPPLTRDIGITVGDFTIAVAVQNLTWGLLQPFAGALAVRTGFRPLMMGGSLLYLIGLVLLATANGLWAVVIGAGVLIGMAMATTGTALAMAAASSAVSQNVRSMILGLVSASGSIGAMIAAPLGQGITGEWGWRMGVAAFAVLAVVMLPAAWFAGRADKVREAPAARAQPEQSGRQALMTALRHPPFVVMALAYTVCGMQLVFLTTHLPAYLEVCGMDPMLSAKALGLIGGFNILGSLFFGWAGGRVNKLLLLGGIYICRSIGFIWFFHALPTPESTMMFSAIMGFLWLGVSPLVQGWIAQTFGLRWQAMIAGVAFFSHQIGSFIGAFGGGWLYDQMQSYSLAWKVGASLGLTLGLIQVAFAFASRPRAPRLVPAAE GT:EXON 1|1-411:0| BL:SWS:NREP 1 BL:SWS:REP 13->80,221->393|YBFB_BACSU|6e-10|23.8|240/416| TM:NTM 11 TM:REGION 11->33| TM:REGION 50->72| TM:REGION 80->102| TM:REGION 111->133| TM:REGION 138->160| TM:REGION 170->192| TM:REGION 223->245| TM:REGION 256->278| TM:REGION 283->305| TM:REGION 309->331| TM:REGION 376->398| SEG 82->94|ggsllyliglvll| SEG 112->130|gmamattgtalamaaassa| SEG 144->155|sasgsigamiaa| SEG 171->185|vaafavlavvmlpaa| SEG 394->405|afafasrprapr| HM:PFM:NREP 2 HM:PFM:REP 22->361|PF07690|3.3e-37|24.7|336/353|MFS_1| HM:PFM:REP 327->409|PF07690|0.00056|20.7|82/353|MFS_1| HM:SCP:REP 1->403|1pw4A_|6.9e-56|25.6|398/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 196 OP:NHOMOORG 153 OP:PATTERN -----------------------1-------------------------------------------- -------------------------------------11---1-----------------------1------------------------------------------------------------------------------1-----------------------1-------------11--------1---------------1111------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------31111121112------------11-11---2----11---1---2111---1111111112-------------41------------------------------1--1--121241111111111111111111-11115434-122-12122122311112-----1---11-1---122------------------------11-1--1--------------------------------1--------------------1---------------------------------------------------------------------------------------------------------------------2---------------111111----1-11111111111111111-----------111-----111-----1-11------------------------------------------------------------------ -------------------------------------------------------------------------------------------------------213--------------------------------------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,190-209,407-412| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //