[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08580.1
DDBJ      :             response regulator receiver domain protein (CheY-like)
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  668/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
c.23.1
:124 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->118 1yioA PDBj 5e-19 41.5 %
:RPS:PDB   10->122 3cu5B PDBj 1e-17 19.5 %
:RPS:SCOP  10->122 1p2fA2  c.23.1.1 * 7e-21 32.7 %
:HMM:SCOP  3->122 1s8nA_ c.23.1.1 * 8e-28 38.5 %
:RPS:PFM   9->119 PF00072 * Response_reg 1e-17 40.7 %
:HMM:PFM   9->118 PF00072 * Response_reg 6.6e-27 33.6 107/112  
:BLT:SWISS 6->122 CHVI_RHISN 5e-17 36.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08580.1 GT:GENE ABF08580.1 GT:PRODUCT response regulator receiver domain protein (CheY-like) GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1841040..1841414 GB:FROM 1841040 GB:TO 1841414 GB:DIRECTION + GB:PRODUCT response regulator receiver domain protein (CheY-like) GB:PROTEIN_ID ABF08580.1 GB:DB_XREF GI:93354491 InterPro:IPR001789 LENGTH 124 SQ:AASEQ MGSSGQFAVVIDDDESVARAISRLLRAAGIAVDTFTSGTVFLDQILSQPAYRPACVILDVSMPHLDGLEVQRRLGGLSLPIIFITAHDVPEARNKALSAGAIGYLRKPFNTQQLIELVRGVMTA GT:EXON 1|1-124:0| BL:SWS:NREP 1 BL:SWS:REP 6->122|CHVI_RHISN|5e-17|36.8|114/241| BL:PDB:NREP 1 BL:PDB:REP 10->118|1yioA|5e-19|41.5|106/198| RP:PDB:NREP 1 RP:PDB:REP 10->122|3cu5B|1e-17|19.5|113/129| RP:PFM:NREP 1 RP:PFM:REP 9->119|PF00072|1e-17|40.7|108/111|Response_reg| HM:PFM:NREP 1 HM:PFM:REP 9->118|PF00072|6.6e-27|33.6|107/112|Response_reg| GO:PFM:NREP 3 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| RP:SCP:NREP 1 RP:SCP:REP 10->122|1p2fA2|7e-21|32.7|107/120|c.23.1.1| HM:SCP:REP 3->122|1s8nA_|8e-28|38.5|117/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 2771 OP:NHOMOORG 680 OP:PATTERN -----------------------------------------------311------------------ 5F52522222321243333-3711343333336556365553364221-532532133--4563635974-211123212532-1-221111---------1---223321--------------1------1--1A99A91--A182B765-4423111315543378B31-12111112116322211-31-5555523426364231211423631333-3343332455-1111111111111133332----------11111----111--1-1111111---22222222222----------------111----3123533322231221233112-3-31-3222-5375422--2422-1-135454441111125G99865A879322222222224-35735546369-5554BA5CHBB8B945154486963534444444412231466-----------------------------1-543342114BAABBAB5555AAIE5355578BC384712554B6999C7A8D437B642674-------1--78K27A723621B3224-B7BC788156677D249--------------------12---227413823234534666-2655476444784--15654------44433523433333343-4334333434433333332333322226555666656666655333433333-322222222222---3---------54623---111-11111--14334425343747767B9A8ACAGF8889----------2325555557747887757455542222--5---2211-------------------------------------4---112-1181 --------------1-----------------------------------------------------------------------------------------------------------------------------------------------1-----------------121------2--5--1--3---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEcEEcccHHHHHHHHHTccTTTccEEEEEEEccHHHHHHHHHHccccEEEEEcccTTccHHHHHHHHHHHcTTEEEEEcTTcHHHHHHHccccccEEEEccccTTHHHHHHHHHHcc DISOP:02AL 1-4,8-9,124-125| PSIPRED ccccccEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHcccccEEEEEccccHHHHHHHHHcccccEEEccccHHHHHHHHHHHHcc //