[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08589.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:123 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08589.1 GT:GENE ABF08589.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1850277..1850648 GB:FROM 1850277 GB:TO 1850648 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF08589.1 GB:DB_XREF GI:93354500 LENGTH 123 SQ:AASEQ MLGSSMAWPKDQLLCARAWLTLSLGAYSTMFKTGYWLIIIGFWAALAGVFLCDPVGGLPENVNLFSFALRGLEIHLFKLSEAPQHYLITVLARDWLIGCFVTMFVGAVLLALGWRRRRQSRLV GT:EXON 1|1-123:0| TM:NTM 3 TM:REGION 3->25| TM:REGION 34->56| TM:REGION 88->110| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,120-124| PSIPRED cccccccccHHHHEEEHHEEHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccccHHHHEEccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //