[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08607.1
DDBJ      :             Uncharacterized protein UPF0065
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  134/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
a.288.1c.94.1e.26.1
:337 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   59->337 2qpqA PDBj 5e-50 35.5 %
:RPS:PDB   59->337 2dvzA PDBj 7e-52 34.6 %
:RPS:SCOP  59->98 1jqkA  e.26.1.2 * 1e-09 22.5 %
:RPS:SCOP  247->335 2o70A1  a.288.1.1 * 2e-22 12.4 %
:HMM:SCOP  135->310 1hslA_ c.94.1.1 * 1.3e-08 21.2 %
:RPS:PFM   61->332 PF03401 * Bug 1e-61 44.5 %
:HMM:PFM   61->334 PF03401 * Bug 3.7e-96 44.5 274/274  
:HMM:PFM   10->95 PF00696 * AA_kinase 0.00058 19.5 77/243  
:BLT:SWISS 59->329 YTCB_PSESQ 1e-45 33.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08607.1 GT:GENE ABF08607.1 GT:PRODUCT Uncharacterized protein UPF0065 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1871006..1872019 GB:FROM 1871006 GB:TO 1872019 GB:DIRECTION + GB:PRODUCT Uncharacterized protein UPF0065 GB:PROTEIN_ID ABF08607.1 GB:DB_XREF GI:93354518 InterPro:IPR005064 LENGTH 337 SQ:AASEQ MTAQKDSRRAARRRLVQAAILASGLMLAVPAMAQSASTQNWPSRPVRVVVPYPPGGVSDAVTRLVMQKLAERIGQPVVVENRPGANGMIGSDNVAKSAPDGYSLLVVVAAHAINPSLYQKMSYDPIRDLTGVSEIGRIPLLMVSSAQLPPKSVKELVSWGKAHPDQMTFASSGSGSGAHLAGELFSQGTGMTMTHVPYKGISPALPDLISGQVAVIFDSVQTMIPLAKAGKVRALAITNPRRWPAAPDVPTMAEAGYPNIMPSSWIGVLAPAKTPTAIIDKLSAELDAVVHAPDVQAKLIDYGIDPVGGKADQFQAFIKEEAGRWASVVQKAGIKLD GT:EXON 1|1-337:0| BL:SWS:NREP 1 BL:SWS:REP 59->329|YTCB_PSESQ|1e-45|33.9|271/336| SEG 8->22|rraarrrlvqaaila| SEG 42->58|psrpvrvvvpyppggvs| SEG 170->182|assgsgsgahlag| BL:PDB:NREP 1 BL:PDB:REP 59->337|2qpqA|5e-50|35.5|279/296| RP:PDB:NREP 1 RP:PDB:REP 59->337|2dvzA|7e-52|34.6|272/292| RP:PFM:NREP 1 RP:PFM:REP 61->332|PF03401|1e-61|44.5|272/274|Bug| HM:PFM:NREP 2 HM:PFM:REP 61->334|PF03401|3.7e-96|44.5|274/274|Bug| HM:PFM:REP 10->95|PF00696|0.00058|19.5|77/243|AA_kinase| GO:PFM:NREP 1 GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF03401|IPR005064| RP:SCP:NREP 2 RP:SCP:REP 59->98|1jqkA|1e-09|22.5|40/610|e.26.1.2| RP:SCP:REP 247->335|2o70A1|2e-22|12.4|89/165|a.288.1.1| HM:SCP:REP 135->310|1hslA_|1.3e-08|21.2|151/238|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 2131 OP:NHOMOORG 138 OP:PATTERN -------------------------------------------------------------------- -------------------------1--------1--1-1----1-------13----------111-111-----------------------------------------------------------------1----------------------------------------------31---11-------------------3------------3--------2--------------------------------------------------------------------------------------------4--------------------------1----44-----1-------1---------------X45--473875----------2-11111---B----4413255223341---4342-232-1--------------1------------------------------------R****-----------------------C****8G322J6sji*d*3**361-----------------1----11-1-1---------------1111------------------------------------------------------------------------------------1-111-------111-1--1-11-112-------1------------------------------------------------------44-----1-------------------2----------------------------1-1-11111--112--1---------------------------------------------------------------2------ --------------------------------------------------------------------------------------------------------------------------------------------------------------L--------------1-----------1--r---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 312 STR:RPRED 92.6 SQ:SECSTR #########################HHHcHHHHHHHHTTTccHHHHHHHHHcEEEEEEHHHHHHHHHHHHHHTTTccEEEEcccGGGHHHHHHHHHccTTccEEEEEHHHHHHHHHcTTTccccTTTcEEEEEEEEEEcEEEEEcTTcccccHHHHHHHHHTcTTTcEEEEccTTcHHHHHHHHHHcGHTcccEEEEcccHHHHHHHHHHTcccEEEEEHGHHHHHHHTTccEEEEEEcccccGGGTTcccTTTTTcGGGcccEEEEEEEETTccHHHHHHHHHHHHHHHTcHHHHHHHHHHTEEEccccHHHHHHHHHHHHHHHHHHHHcTTcccc DISOP:02AL 1-13,337-338| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHccccccEEEEEEccHHHHHHHHcccccccHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHccccEEEEccccHHHHHHHHHcccccEEEEcHHHHHHHHHcccEEEEEEEcccccccccccccHHHcccccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHccHHHHHHHHHcccEEccccHHHHHHHHHHHHHHHHHHHHHcccccc //