[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08608.1
DDBJ      :             L-carnitine dehydratase/bile acid-inducible protein F
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  369/915 : Eukaryota  154/199 : Viruses  0/175   --->[See Alignment]
c.123.1
:405 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->204,269->405 1pt8A PDBj 2e-29 38.1 %
:RPS:PDB   84->198 2c9eA PDBj 7e-32 6.3 %
:RPS:SCOP  5->405 1xa3A  c.123.1.1 * e-101 23.6 %
:HMM:SCOP  1->405 1q7eA_ c.123.1.1 * 8e-139 42.9 %
:RPS:PFM   76->268 PF02515 * CoA_transf_3 2e-37 41.8 %
:HMM:PFM   76->268 PF02515 * CoA_transf_3 2.4e-67 45.5 189/191  
:BLT:SWISS 5->405 CG010_MOUSE 6e-79 40.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08608.1 GT:GENE ABF08608.1 GT:PRODUCT L-carnitine dehydratase/bile acid-inducible protein F GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1872129..1873346) GB:FROM 1872129 GB:TO 1873346 GB:DIRECTION - GB:PRODUCT L-carnitine dehydratase/bile acid-inducible protein F GB:PROTEIN_ID ABF08608.1 GB:DB_XREF GI:93354519 InterPro:IPR003673 LENGTH 405 SQ:AASEQ MSAILQGIKVLDLTRVVAGPWATQNLADMGATVYKIEKPGDGDDTRRMGPFLTDGDGNVTNDSAFFLCCNRGKQSVTVDISQPEGAELVRQLASHCDVVVENYKAGSLKKYGLDYESIRALRPDIIYCSVTGFGPDGPYAPRPAYDFILQGMAGLMSTCGQPDGTPGAAPMRTAIPLTDILTGLYASVALMGALYHRQATGEGQFIDAAMIDAAVAANGHLALGYHMTGKVPQRAGNSNPVASPSEVFACLDGHVIIAAGNNGQFAALCRVIGCASLIEDPRFLQNMDRVRNRPVLRETLGERLLNWRLADLIQALEGAGVPCGPINDIDDVFDDPQVRHRELLVRLPHGSGVEAPTLRSPLRFSATPVTMTAPPQLGQHTEAALRSELGMSAADVEAFRERGVI GT:EXON 1|1-405:0| BL:SWS:NREP 1 BL:SWS:REP 5->405|CG010_MOUSE|6e-79|40.4|391/436| SEG 206->217|idaamidaavaa| BL:PDB:NREP 1 BL:PDB:REP 1->204,269->405|1pt8A|2e-29|38.1|330/416| RP:PDB:NREP 1 RP:PDB:REP 84->198|2c9eA|7e-32|6.3|111/317| RP:PFM:NREP 1 RP:PFM:REP 76->268|PF02515|2e-37|41.8|189/189|CoA_transf_3| HM:PFM:NREP 1 HM:PFM:REP 76->268|PF02515|2.4e-67|45.5|189/191|CoA_transf_3| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02515|IPR003673| GO:PFM GO:0008152|"GO:metabolic process"|PF02515|IPR003673| RP:SCP:NREP 1 RP:SCP:REP 5->405|1xa3A|e-101|23.6|381/400|c.123.1.1| HM:SCP:REP 1->405|1q7eA_|8e-139|42.9|394/417|c.123.1.1|1/1|CoA-transferase family III (CaiB/BaiF)| OP:NHOMO 2554 OP:NHOMOORG 546 OP:PATTERN --1----232523322-11321-51--12-32-----------------------------1-2---- --235--2---1--5UI44-4G--CS444448FDHE5HRi-K3Y1--2----442212--12B123B6635-111----1616------------------2------12--------------------------66686---32----------------------------------------11---11----------------1--------22323--------1----------------------2------2-1--11--------------------------------------------------------12--2222222-2--3-------1---1----87-1----1--------1--633A-----2-JBC--7B59A533442443442-34A33E39855-41111222133296472759222426722222222511--723------------------------------47F7-5uaHfEDDFIF5577799GE887858V6TQbkc2678564898N8H9OT456----21-------1--922-121------------2--2----111111-6---------------------------1---1-4-3--1------1----1-11-1--------------1-2-3--3443333333-2333333333233223221------111111111111111111122333321-----------------111111111-2212---------------44324242222155553656342455223------------------------------------------111111------------------------------------------------- ----111-----1126565644269773311112214666566222334867C9668124331-1---------1------111-1---25453243111113432-2-24252231111222223251AU3-6332222412222212221151632723112222232A1222-1------111--83---11111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 405 STR:RPRED 100.0 SQ:SECSTR cccTTTTcEEEEcccTTHHHHHHHHHHHTTcEEEEEEcTTTccGGGcTTcccTTcTTTcccccHHHHTTcTTcEEEEccTTcHHHHHHHHHHHHHHHHHHTTccTTcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHTTcTTccccccccHHHHHHHHHHHHHHHHTccHHHHHHGHHccccEEEEEHHHHHHHHTHHHHHHHHTTcccccccTTcccccTTEEEEEETTEEEEEEcccHHHHHHHHHHTTcGGGcccTTTccHHHHGGGHHHHHHHHHHHHTTccHHHHHHHHGGGTccEEEcccHHHHHHcHHHHHTTcEEEEEETTTEEEEEEccccccTTccccccccccTTTTHHHHHHHHTTccHHHHHHHHHTTcc DISOP:02AL 1-1| PSIPRED ccccccccEEEEEccHHHHHHHHHHHHHHccEEEEEEccccccHHHccccccccccccccccHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHccEEEEcccHHHHHHccccHHHHHHHcccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEcccccEEEEEccHHHHHHHHHHcccHHHcccHHHccccHHHccHHHHHHHHHHHHHcccHHHHHHHHHHccccEEEcccHHHHHHcHHHHHcccEEEEEccccccEEEEccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHcccc //