[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08625.1
DDBJ      :             putative transposase protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08625.1 GT:GENE ABF08625.1 GT:PRODUCT putative transposase protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1893801..1894040 GB:FROM 1893801 GB:TO 1894040 GB:DIRECTION + GB:PRODUCT putative transposase protein GB:PROTEIN_ID ABF08625.1 GB:DB_XREF GI:93354536 LENGTH 79 SQ:AASEQ MAEYPEGHVELWADAAPLPYTTYDRFPEVDQRAIVDNKRQGLALASTAEGQERTAHSPLTGHSNVVSPPSNGPSQSRHR GT:EXON 1|1-79:0| SEG 63->76|snvvsppsngpsqs| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,49-80| PSIPRED ccccccccEEEEEccEEcccccccccccccHHHHHccHHHHHHHHHHHHHHHHcccccccccccEEccccccccHHccc //