[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08673.1
DDBJ      :             protein of unknown function DUF214
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  58/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:388 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   252->379 PF02687 * FtsX 1e-07 28.3 %
:HMM:PFM   206->381 PF02687 * FtsX 1.1e-24 24.6 171/175  
:BLT:SWISS 244->386 MACB_BDEBA 6e-10 31.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08673.1 GT:GENE ABF08673.1 GT:PRODUCT protein of unknown function DUF214 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1946109..1947275 GB:FROM 1946109 GB:TO 1947275 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF214 GB:PROTEIN_ID ABF08673.1 GB:DB_XREF GI:93354584 InterPro:IPR003838 LENGTH 388 SQ:AASEQ MVIPLHYIARNVWARRLTTTLTAGGLALVVFVFATMLMLDAGLKRTLVTTGERDNVVLIRKGAETEIQSAISRDQAAAMEMHSAVALTPEGRPMSSREAVVLISLTKTGYTTPSNVVIRGITPLGVEMRPQVRLTRGRMFKPGSSEIIVGSSIAKGYDNVSIGDHLRFAQRDWTVVGHFDAGGSGFDSEIWGDVDQLMQSFRRTSYSSMAVRLADSDAFDRFRADIDVDPRLANEAKREQQFYSDQSKALSAFINILGLTLTTIFSVAAMIGAMITMYASVANRVGEIGTLRALGFQRINVLAAFLIEAVLLGLVGGVAGLLCASLMQFASFSTTNFQTFADLSFRFVLTPGIVIKTLLFSMTMGLIGGFLPALRASRLNIVDALRAR GT:EXON 1|1-388:0| BL:SWS:NREP 1 BL:SWS:REP 244->386|MACB_BDEBA|6e-10|31.1|135/650| TM:NTM 4 TM:REGION 21->43| TM:REGION 253->275| TM:REGION 300->322| TM:REGION 346->368| SEG 14->28|arrltttltagglal| SEG 212->229|rladsdafdrfradidvd| SEG 309->322|avllglvggvagll| RP:PFM:NREP 1 RP:PFM:REP 252->379|PF02687|1e-07|28.3|127/177|FtsX| HM:PFM:NREP 1 HM:PFM:REP 206->381|PF02687|1.1e-24|24.6|171/175|FtsX| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF02687|IPR003838| OP:NHOMO 60 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- -11-----------------------------------------------------------------------------------------------------------------------------11-1-----------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------1---11-111------1------------------------1-----------------------------------------111111-----11-1------11-1111------------------1----------------------------1---1-111-111-1-----111--------------------------------1-----------------------1---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111-----------------------------------------------------------1-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 65-73,388-389| PSIPRED ccccHHHHHHHHHHHHHHHHcccccEEEEEEEEHHHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHHHHHHHccccEEcccccEEEEccEEEEEccccccccccccEEEEEEccHHHHHcccEEEEEcccccccccEEEEEHHHHccccccccccEEEEccEEEEEEEEEcccccccccEEEEEHHHHHHHHccccEEEEEEEEEccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccc //