[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08674.1
DDBJ      :             transcriptional regulator, LysR family
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  704/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:296 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->267 3hhgG PDBj 7e-16 29.1 %
:RPS:PDB   1->237 1b9nB PDBj 3e-24 11.9 %
:RPS:SCOP  1->101 1b9mA1  a.4.5.8 * 6e-20 13.9 %
:RPS:SCOP  93->295 1i69A  c.94.1.1 * 5e-27 23.5 %
:HMM:SCOP  3->89 1ixcA1 a.4.5.37 * 5e-22 34.5 %
:HMM:SCOP  84->296 1uthA_ c.94.1.1 * 1.9e-34 28.4 %
:RPS:PFM   5->64 PF00126 * HTH_1 3e-10 46.7 %
:RPS:PFM   92->293 PF03466 * LysR_substrate 1e-15 28.9 %
:HMM:PFM   91->295 PF03466 * LysR_substrate 1.7e-43 30.4 204/209  
:HMM:PFM   5->63 PF00126 * HTH_1 2.3e-23 45.8 59/60  
:BLT:SWISS 3->289 YWBI_BACSU 5e-55 39.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08674.1 GT:GENE ABF08674.1 GT:PRODUCT transcriptional regulator, LysR family GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1947324..1948214) GB:FROM 1947324 GB:TO 1948214 GB:DIRECTION - GB:PRODUCT transcriptional regulator, LysR family GB:PROTEIN_ID ABF08674.1 GB:DB_XREF GI:93354585 InterPro:IPR000847 InterPro:IPR005119 LENGTH 296 SQ:AASEQ MPIDIRALRYFVETARLRSFTQAASSLFVTQSTISKMVKQLEDEVGQPLLIREGKTVRLTDVGKVVYDRGQEALGVVHRLTLEVADLSSLGRGQLTVGVPPMVNLFFSPAVSAFRRRYPNLQLNLSEHGGKIVEQQVAHGELEVGATVLPGDSGLNLETRQFAKYPIWAVGPHRAAWASGRTVTLAALRDEPLVMLTDEFSLTRMLRQAFTDARFEPHVVAQSGHWDFLASMAAAGLGTTFLPEPLLSRLESRDKLAVARLTEPTVDWALAHIWSPGRYLSHAARAWLEVCEEVMG GT:EXON 1|1-296:0| BL:SWS:NREP 1 BL:SWS:REP 3->289|YWBI_BACSU|5e-55|39.3|285/301| BL:PDB:NREP 1 BL:PDB:REP 1->267|3hhgG|7e-16|29.1|254/294| RP:PDB:NREP 1 RP:PDB:REP 1->237|1b9nB|3e-24|11.9|227/245| RP:PFM:NREP 2 RP:PFM:REP 5->64|PF00126|3e-10|46.7|60/60|HTH_1| RP:PFM:REP 92->293|PF03466|1e-15|28.9|201/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 91->295|PF03466|1.7e-43|30.4|204/209|LysR_substrate| HM:PFM:REP 5->63|PF00126|2.3e-23|45.8|59/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 1->101|1b9mA1|6e-20|13.9|101/122|a.4.5.8| RP:SCP:REP 93->295|1i69A|5e-27|23.5|196/206|c.94.1.1| HM:SCP:REP 3->89|1ixcA1|5e-22|34.5|87/0|a.4.5.37|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 84->296|1uthA_|1.9e-34|28.4|211/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 6246 OP:NHOMOORG 713 OP:PATTERN -----------------------------------------------------1-------------- 364-81-12222--643----21119-----133435AKK-5153112-11-6431-3--222154LBAB4-222-12211652111-2211-1-----11611241213---------------1---1----1-34422---317235445233311111123285351111111111111132-----52CAAAAA999497A9A863B8DEA79243A141455444MX-1111111111111132228145354325238833674352221122221111--------------1222112122222---111---2-31E9555556535328221111531-141511EG451-1-432121-123228221-----16JIH3469F7B96685657567G-55955QC9BH5-PGGHAFGRRHFDOG13277G44463ED8788888867775255------------------------------17821IufUYoxy**qPLNMMllrjSQSSGP*dtUmmc-4MJGACACBaCS6YH9BA5542J6112222221347A52312341156443-41474634233348713--2------------------1---98FFE456E58D7EGFGF37CECC8ECFD8GC1-13557------K8FC5HEGGGDGEDCFE-GEFFHADDGDGEEEEFFEBRWRFH487GAGEHFIHHGHGHGEHVAB8AAAC5-756566556666---7111112433369HM555546243343333EDFEI8B477N7XWVXVdUaHbhbTBLNP-111111114ACAEABBBBAFCFE8CBCECB6672222--3211------------1-------------------------------------261 -------------2------------------------------------------------------------------------------------------------------------------------------------------------8----1-1---------1---------1--6-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 296 STR:RPRED 100.0 SQ:SECSTR EEEcHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHTccccccccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcTTccccccHHHHHHTTTcTccccccEEEEEEEcccEEEEEETTcccEEEEEccHHHHHHHTccTTEEEEcGGGcEEEccHHHHTTccEEEEEEEEEEEEcccEEEEEEEcTTccEEHEEEEEGGGcTTccTTcEEEEEcHEcGGGcEEEcccEEEEEGGGccTTTTcTTcEEEEccTTcccEEEEEEEETTccccHHHHHHHHHHcTTcc DISOP:02AL 86-89| PSIPRED ccccHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHccEEEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccccEEEEEccccccccEEEEEEEEccEEEEEcccccccccccccHHHHccccEEEcccccHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHccccEEEEEHHHHHHHHccccEEEEEccccccEEEEEEEEcccccccHHHHHHHHHHHHHcc //