[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08676.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->14 PF08254 * Leader_Thr 0.00093 66.7 9/22  
:REPEAT 3|47->57|60->70|73->83
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08676.1 GT:GENE ABF08676.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1950403..1950720 GB:FROM 1950403 GB:TO 1950720 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF08676.1 GB:DB_XREF GI:93354587 LENGTH 105 SQ:AASEQ MLKALIATTITTTLLGASALAVAQPPQGLQDRGVPADRYGYEMHIGKRDPYTDGAHGIRQRDPYTDGAHGIRERDPYTDGAHGSAGMNLAGLDRTGVSAPPAHSA GT:EXON 1|1-105:0| NREPEAT 1 REPEAT 3|47->57|60->70|73->83| SEG 2->21|lkaliattitttllgasala| HM:PFM:NREP 1 HM:PFM:REP 6->14|PF08254|0.00093|66.7|9/22|Leader_Thr| OP:NHOMO 19 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------5464---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,95-106| PSIPRED cHHHHHHHHHHHHHHccHHHHHccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //