[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08678.1
DDBJ      :             transcriptional regulator, ArsR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  169/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:121 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->97 3f6oB PDBj 2e-21 47.1 %
:RPS:PDB   18->106 1biaA PDBj 5e-14 18.0 %
:RPS:SCOP  11->89 1r1uA  a.4.5.5 * 7e-15 20.3 %
:HMM:SCOP  7->112 2p4wA1 a.4.5.64 * 5.5e-24 34.0 %
:RPS:PFM   20->64 PF01022 * HTH_5 8e-07 53.3 %
:HMM:PFM   20->65 PF01022 * HTH_5 2.8e-14 47.8 46/47  
:BLT:SWISS 12->73 YUZN_BACSU 7e-08 46.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08678.1 GT:GENE ABF08678.1 GT:PRODUCT transcriptional regulator, ArsR family GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1951971..1952336) GB:FROM 1951971 GB:TO 1952336 GB:DIRECTION - GB:PRODUCT transcriptional regulator, ArsR family GB:PROTEIN_ID ABF08678.1 GB:DB_XREF GI:93354589 InterPro:IPR001845 LENGTH 121 SQ:AASEQ MLNYSDPHVALDATFQALADTTRRTMLAQLARGPLSVTELARPLAMSLPAVMQHLSVLEQAGLVRTEKVGRVRTCTMAPKALSEAEQWINARRAEWEGHFDRLGEYLETMKKEAASDGNGN GT:EXON 1|1-121:0| BL:SWS:NREP 1 BL:SWS:REP 12->73|YUZN_BACSU|7e-08|46.8|62/92| BL:PDB:NREP 1 BL:PDB:REP 11->97|3f6oB|2e-21|47.1|87/91| RP:PDB:NREP 1 RP:PDB:REP 18->106|1biaA|5e-14|18.0|89/292| RP:PFM:NREP 1 RP:PFM:REP 20->64|PF01022|8e-07|53.3|45/47|HTH_5| HM:PFM:NREP 1 HM:PFM:REP 20->65|PF01022|2.8e-14|47.8|46/47|HTH_5| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01022|IPR001845| GO:PFM GO:0005622|"GO:intracellular"|PF01022|IPR001845| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01022|IPR001845| RP:SCP:NREP 1 RP:SCP:REP 11->89|1r1uA|7e-15|20.3|79/94|a.4.5.5| HM:SCP:REP 7->112|2p4wA1|5.5e-24|34.0|106/0|a.4.5.64|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 360 OP:NHOMOORG 169 OP:PATTERN -------------------------------------------------------------------- 137-3---------21111-12--1211111154443365-1221511---1331--3--211-3-3-2--------------------------------1---1-4-3------------------------------------1-------------------1--1-------------1----------11111111-1111111111--111---1---------22------------------------------------------------------------------------------------------------------------------------------------1-------5--5113-----134321-1---------------3--111----796-244-54165445--2231521111112-----------------------------------------------112--2222122221-----221-------41-2212--112-----1-1-1--1--------------------1-----------------------324247-------------------------------------------------------------------------------------------------------------------------------------2------------------------------------1----------------------------1-----------------------------------------22----------------332222-----------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 95.9 SQ:SECSTR HHHHcccTHHHHHHHHccccHHHHHHHHHHTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccHHHHHHTcccccEEEccccccHHHHHcHEEEcc##### DISOP:02AL 1-8,107-122| PSIPRED cccccHHHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //