[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08679.1
DDBJ      :             transcriptional regulator, MarR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  59/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:183 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   48->147 2fa5B PDBj 6e-07 33.0 %
:RPS:PDB   19->147 2a61A PDBj 2e-12 19.5 %
:RPS:SCOP  19->147 2a61A1  a.4.5.28 * 4e-14 19.5 %
:HMM:SCOP  13->150 1jgsA_ a.4.5.28 * 4.6e-27 30.1 %
:HMM:PFM   45->101 PF01047 * MarR 3.6e-14 28.1 57/59  
:BLT:SWISS 65->147 SLYA_YEREN 2e-07 30.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08679.1 GT:GENE ABF08679.1 GT:PRODUCT transcriptional regulator, MarR family GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1952517..1953068) GB:FROM 1952517 GB:TO 1953068 GB:DIRECTION - GB:PRODUCT transcriptional regulator, MarR family GB:PROTEIN_ID ABF08679.1 GB:DB_XREF GI:93354590 InterPro:IPR000835 LENGTH 183 SQ:AASEQ MAQETSGTLQAPGRLVDFINYRLYHLSRVAMAASGLHLRAAAGVSRREWRMLAFLGEQPGTRLTELAASAGLDKVLASRAVHGLIDKGLVRRDSREGDRRAAAFRLTEAGESVYAAAFARARDFNRELAGCLNEDEAEMFSRCLDKLHAQAMTMLLAAKPLADRSDAADAPAFEDPLNVWRKR GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 65->147|SLYA_YEREN|2e-07|30.1|83/143| SEG 115->124|aaafarardf| BL:PDB:NREP 1 BL:PDB:REP 48->147|2fa5B|6e-07|33.0|88/136| RP:PDB:NREP 1 RP:PDB:REP 19->147|2a61A|2e-12|19.5|128/142| HM:PFM:NREP 1 HM:PFM:REP 45->101|PF01047|3.6e-14|28.1|57/59|MarR| RP:SCP:NREP 1 RP:SCP:REP 19->147|2a61A1|4e-14|19.5|128/139|a.4.5.28| HM:SCP:REP 13->150|1jgsA_|4.6e-27|30.1|136/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 78 OP:NHOMOORG 60 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-------322--------------------------1--------------------11---------1--------------21-------------------------------1-1--11-31111111111222211111111113131-------1--3---2-------------------------------------------------------------------------------------------1------------------1------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------111111111--------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 161 STR:RPRED 88.0 SQ:SECSTR ###ccccccccHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHTTccHHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcTGGGccTTcE################### DISOP:02AL 1-11,154-173,181-184| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHcc //