[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08688.1
DDBJ      :             thiamine pyrophosphate enzyme-like TPP-binding
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  58/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
c.36.1
:399 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   243->302 1ybhA PDBj 3e-06 45.6 %
:RPS:PDB   172->359 1bfdA PDBj 2e-13 20.1 %
:RPS:SCOP  7->159 1bfdA2  c.36.1.5 * 1e-09 25.7 %
:RPS:SCOP  200->384 1powA3  c.36.1.9 * 2e-14 16.9 %
:HMM:SCOP  1->164 1q6zA2 c.36.1.5 * 2.9e-13 24.4 %
:HMM:SCOP  195->376 1ozhA3 c.36.1.9 * 3.9e-28 28.6 %
:RPS:PFM   243->310 PF02775 * TPP_enzyme_C 6e-07 47.8 %
:HMM:PFM   237->355 PF02775 * TPP_enzyme_C 1.1e-18 33.6 116/150  
:HMM:PFM   7->162 PF02776 * TPP_enzyme_N 4.7e-13 23.0 148/172  
:BLT:SWISS 23->380 PPD_STRHY 3e-58 38.2 %
:PROS 254->273|PS00187|TPP_ENZYMES
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08688.1 GT:GENE ABF08688.1 GT:PRODUCT thiamine pyrophosphate enzyme-like TPP-binding GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1961124..1962323 GB:FROM 1961124 GB:TO 1962323 GB:DIRECTION + GB:PRODUCT thiamine pyrophosphate enzyme-like TPP-binding GB:PROTEIN_ID ABF08688.1 GB:DB_XREF GI:93354599 InterPro:IPR000399 InterPro:IPR011766 LENGTH 399 SQ:AASEQ MIEAVQFVEAARERGFEWYAGVPCSYLTPFINYVVQDPSLHYVSAANEGDAVAFIAGVTQGARNGVRGITMMQNSGLGNAVSPLTSLTWTFRLPQLLIVTWRGQPGGASDEPQHALMGPVTPAMLDTMEIPWELFPTEPDAVGPALDRAIAHMDATGRPYALIMQKGSVAPYPLKTQTPPVARAKATPQVSRSGATPLPSRQEALQRVIAHTPADSTVVLASTGFCGRELYALDDRPNQLYMVGSMGCLTPFALGLAMARPDLKVVAVDGDGAALMRMGVFATLGAYGPANLTHVLLDNNAHDSTGGQATVSHNVSFAGVAAACGYASAIEGDDLDMLDRVLASAATATSGPNFVCLQTRAGTPDGLPRPSVTPVEVKTRLGRQIGADQGHAGEKHAAA GT:EXON 1|1-399:0| BL:SWS:NREP 1 BL:SWS:REP 23->380|PPD_STRHY|3e-58|38.2|351/401| PROS 254->273|PS00187|TPP_ENZYMES|PDOC00166| SEG 318->329|agvaaacgyasa| BL:PDB:NREP 1 BL:PDB:REP 243->302|1ybhA|3e-06|45.6|57/581| RP:PDB:NREP 1 RP:PDB:REP 172->359|1bfdA|2e-13|20.1|184/523| RP:PFM:NREP 1 RP:PFM:REP 243->310|PF02775|6e-07|47.8|67/139|TPP_enzyme_C| HM:PFM:NREP 2 HM:PFM:REP 237->355|PF02775|1.1e-18|33.6|116/150|TPP_enzyme_C| HM:PFM:REP 7->162|PF02776|4.7e-13|23.0|148/172|TPP_enzyme_N| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02775|IPR011766| GO:PFM GO:0030976|"GO:thiamin pyrophosphate binding"|PF02775|IPR011766| RP:SCP:NREP 2 RP:SCP:REP 7->159|1bfdA2|1e-09|25.7|144/180|c.36.1.5| RP:SCP:REP 200->384|1powA3|2e-14|16.9|183/228|c.36.1.9| HM:SCP:REP 1->164|1q6zA2|2.9e-13|24.4|156/0|c.36.1.5|1/2|Thiamin diphosphate-binding fold (THDP-binding)| HM:SCP:REP 195->376|1ozhA3|3.9e-28|28.6|175/192|c.36.1.9|1/1|Thiamin diphosphate-binding fold (THDP-binding)| OP:NHOMO 112 OP:NHOMOORG 88 OP:PATTERN --------------------------------2112-22222111111221111-------------- ---------------------------------------1-1--------------------------1-------------------211--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------1---------------------------------------111--------------------1----1113---1--2--------------------2------------------------------------------------------11--2111121111111112222-1112---1------------------------------------1--1---------------------------2----------1----------------------------------1----------------1-------------1-----------------------------------11-------------------------------------------1----------------------------------------------------------1--------------------------------------------------------1--------------------------------------1- --------211----------------------------------------1-1-----------------------------------------------------1--------------------------------------------------------1--------1-------1----------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 382 STR:RPRED 95.7 SQ:SECSTR ######HHHHHHHTTccEEEEcccGGGHHHHHHHHHccccEEcccccHHHHHHHHHHH###HHHHcccEEEEEcTTHH#HHTTHHHHHHHHTccEEEEEEEccGGGTTTTcTTcHHHGGGcHHHcGGGcccEEEEcccGGGHHHHHHHHHHHHHcccccEEEEEEETHHHHHHcccccccccccccccccccccccccHcHHHHHHHHHHHccTTcEEEEEcGGGHHHHHHHccccTTcEEETcccccHHHHHHHHHHHcTTccEEEEEEHHHHTTTGGGHHHHHHHTTcccEEEEEEccccHHHHHHccccccccHcHHHHHHTTcEEEEEccHHHHHHHHHHHHHHccccEEEEEEccTTccccccTTTcHHHHHHHHHHHTHHHHHHHH####### DISOP:02AL 1-1,388-400| PSIPRED cccHHHHHHHHHHccccEEEEccccHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHcccccHHHHHHcccccccccHHHHHHHHHHHccccccEEEEcccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccEEEEEEccHHHHHcccHHHHHHHHccccEEEEEEEccccccccccccccccccHHHHHHHcccccEEEEccHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccHHHHHHHHHHHHHccccccccHHccc //