[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08706.1
DDBJ      :             DNA polymerase III, delta prime subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  665/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:337 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->182 1xxhB PDBj 1e-17 37.8 %
:RPS:PDB   56->193 3c58A PDBj 6e-14 4.3 %
:RPS:SCOP  18->195 1jr3A2  c.37.1.20 * 8e-34 33.8 %
:HMM:SCOP  3->222 1a5tA2 c.37.1.20 * 5.6e-46 36.2 %
:HMM:PFM   25->179 PF00004 * AAA 0.00026 26.6 109/130  
:BLT:SWISS 2->193 HOLB_PSEAE 1e-25 41.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08706.1 GT:GENE ABF08706.1 GT:PRODUCT DNA polymerase III, delta prime subunit GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(1982842..1983855) GB:FROM 1982842 GB:TO 1983855 GB:DIRECTION - GB:PRODUCT DNA polymerase III, delta prime subunit GB:PROTEIN_ID ABF08706.1 GB:DB_XREF GI:93354617 InterPro:IPR000862 InterPro:IPR004622 LENGTH 337 SQ:AASEQ MLYPWQRDDWHRLTALRDRLPHALLLHGQQGIGKRDLALHFAQGLLCESALPDGQPCNTCSACHWFGQGNHPDFTVVRPEALEAGAGEAEGDGESGSKKKAPSKIIRMEQVRALIEAVGVGTHRAGLRVVVVYPLDALQTEGANALLKTLEEPPPSTVFLLVTDRIDRVLPTILSRCRQFSMTRPTSADALDWLRGQGVADVEAQLALAGGAPLTALHAAEAEEQPLQRWLVGQLGSAAALDALAAAEQLQKLPVPAVLGTLQRWTYDLLALCLGTGAARYFPKEQTALARCASATDAHRLQAFAARLVGHRRNENHPLAARLVMESVLLDYRQLFR GT:EXON 1|1-337:0| BL:SWS:NREP 1 BL:SWS:REP 2->193|HOLB_PSEAE|1e-25|41.2|170/328| SEG 80->101|ealeagageaegdgesgskkka| SEG 204->220|aqlalaggapltalhaa| SEG 238->247|aaaldalaaa| BL:PDB:NREP 1 BL:PDB:REP 11->182|1xxhB|1e-17|37.8|148/364| RP:PDB:NREP 1 RP:PDB:REP 56->193|3c58A|6e-14|4.3|117/269| HM:PFM:NREP 1 HM:PFM:REP 25->179|PF00004|0.00026|26.6|109/130|AAA| RP:SCP:NREP 1 RP:SCP:REP 18->195|1jr3A2|8e-34|33.8|154/240|c.37.1.20| HM:SCP:REP 3->222|1a5tA2|5.6e-46|36.2|199/0|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 770 OP:NHOMOORG 666 OP:PATTERN -------------------------------------------------------------------- -1---1--111-1111111-11111111111111111111--111-11---111--11--1111111-111-------1---221212111111111--11112112121--------------2221-111211-2212211111121-1112211111121221-3311122211121222111--11---111111111111112111111111111121--1111111111111111-111111-11111-1-11-2---111111211---11111111111111111111111111111111111111-111111111--11----------1-111----21-11--221111221122221111---1111-1111-211--1111-11122222222222-1-1111-11---111-2211112111211121111112211111111122221-------------------------------11122211111111111111111111111111111111111111111111111111121111111111111111112121121--111--11111-1111122121-11-------------------------11211111111-1111111-11111-11111-1-121121--11111111--1111111111-111111111111111111----111111111111111111111-11111111-111111111111-1--1111111112211211111111111111111111111--2222222222222222222---------11-1111111111111111111111------11------------------------------------------1--1-1-111--1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 177 STR:RPRED 52.5 SQ:SECSTR ##cGGGHHHHHHHHHHTTccccEEEEEccTTccHHHHHHHHHHHHTcccccTTccHHHHHHHHHHHHTTccccEEEEcccTT#################cGGGcTTcHHHHHHHHTTccEEEEEEETTEEEEETEEEEEEcTTTcEEEEEcTTccEEEEEccccEEEEEcTTcccEEEEEEGGGHHHHHHHHTccc############################################################################################################################################# DISOP:02AL 85-107| PSIPRED ccccccHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHccccccEEEEEHHHHHccccccccccccccHHHcccccccHHHHHHHHHHHHHcHHHcccEEEEEccHHHccHHHHHHHHHHHHcccccEEEEEEEccHHHcccHHHEEEEEEEcccccHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHc //