[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08710.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->53 PF10604 * Polyketide_cyc2 0.00036 27.3 33/139  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08710.1 GT:GENE ABF08710.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 1986764..1987054 GB:FROM 1986764 GB:TO 1987054 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF08710.1 GB:DB_XREF GI:93354621 LENGTH 96 SQ:AASEQ MSDHLYVYFKVPDDRAAEALPHWHRWMETVAEATGVGGTLMRRPETRAGLQTWMECYADVPPAFDAALDGLWRQSGLTQWISGERMSERFVDLDVL GT:EXON 1|1-96:0| HM:PFM:NREP 1 HM:PFM:REP 19->53|PF10604|0.00036|27.3|33/139|Polyketide_cyc2| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cccEEEEEEEEccccHHHHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHcccc //