[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08736.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:144 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   77->136 PF04238 * DUF420 3.1e-06 20.0 60/133  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08736.1 GT:GENE ABF08736.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2013700..2014134) GB:FROM 2013700 GB:TO 2014134 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF08736.1 GB:DB_XREF GI:93354647 LENGTH 144 SQ:AASEQ MNGVIELFGWFVFNVALPLGAPLALLPLARVPSFFRAHRRGIVWHAIKGGQLLWAVIPMSASACHLLATALEIPGVSDALRPYIWFVMAIHVVVIVAASVLVLFATMDAHQRDVLAHSQAQRIPRSWVWLTCMSGASILWATWL GT:EXON 1|1-144:0| TM:NTM 4 TM:REGION 8->30| TM:REGION 52->74| TM:REGION 84->106| TM:REGION 123->144| SEG 16->29|alplgaplallpla| SEG 86->105|fvmaihvvvivaasvlvlfa| HM:PFM:NREP 1 HM:PFM:REP 77->136|PF04238|3.1e-06|20.0|60/133|DUF420| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHcccHHHHHHcccEEEEEEEcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHcc //