[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08745.1
DDBJ      :             intracellular septation protein A
Swiss-Prot:ISPZ_RALME   RecName: Full=Probable intracellular septation protein;

Homologs  Archaea  0/68 : Bacteria  353/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:179 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->175 PF04279 * IspA 5e-43 53.2 %
:HMM:PFM   1->175 PF04279 * IspA 2.6e-74 56.0 175/176  
:BLT:SWISS 1->179 ISPZ_RALME e-104 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08745.1 GT:GENE ABF08745.1 GT:PRODUCT intracellular septation protein A GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2023877..2024416 GB:FROM 2023877 GB:TO 2024416 GB:DIRECTION + GB:PRODUCT intracellular septation protein A GB:PROTEIN_ID ABF08745.1 GB:DB_XREF GI:93354656 InterPro:IPR006008 LENGTH 179 SQ:AASEQ MKFLFDLFPVILFFVAFKLFGIYPATAVAIGATVVQIAWVHFRHGKAEPMQWVSLAIIAVFGGATILLHNETFIKWKPTVLYWLFAVTLIGSVIGWRKNLIRAMMEKQVTLPEPMWGRLNVAWAGFFAVMGVLNLYVAYQFSTDTWVNFKLFGSMGLMLVFIVAQSIWLSRHIQETPSE GT:EXON 1|1-179:0| SW:ID ISPZ_RALME SW:DE RecName: Full=Probable intracellular septation protein; SW:GN Name=ispZ; OrderedLocusNames=Rmet_1866; SW:KW Cell cycle; Cell division; Cell inner membrane; Cell membrane;Complete proteome; Membrane; Septation; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->179|ISPZ_RALME|e-104|100.0|179/179| GO:SWS:NREP 7 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000917|"GO:barrier septum formation"|Septation| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 12->34| TM:REGION 48->70| TM:REGION 77->96| TM:REGION 147->169| RP:PFM:NREP 1 RP:PFM:REP 2->175|PF04279|5e-43|53.2|173/175|IspA| HM:PFM:NREP 1 HM:PFM:REP 1->175|PF04279|2.6e-74|56.0|175/176|IspA| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF04279|IPR006008| OP:NHOMO 356 OP:NHOMOORG 355 OP:PATTERN -------------------------------------------------------------------- --------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111-11-11111112111111111111111-----1----111-------------1-1------------1111111111111----111111111111111111111111111111111111111111111111111111111111111111111111111111--------------------------------------------------------11111---11--11111111111111111111--11--111-11111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--1111111111111111111111111111111111111-1111-11111111-1111-111111111111111111111111111--------------111-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 171-172,174-180| PSIPRED cHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccHHHEEHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //